IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ IκB-Kinase-epsilon (IKKε) over-expression promotes the growth of prostate cancer through the C/EBP-β dependent activation of IL-6 gene expression. IκB-Kinase-epsilon (IKKε) over-expression promotes the growth of prostate cancer through the C/EBP-β dependent activation of IL-6 gene expression. Oncotarget 2017 imex curation Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM., Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM. Cancer - Interactions investigated in the context of cancer Coronavirus - Interactions investigated in the context of Coronavirus included in coronavirus dataset as "Interactions between human proteins relevant for SARS-CoV2 infection have also been included". anne-marie.mes-masson@umontreal.ca 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-22rv1 Homo sapiens 22rv1 Human prostate adenocarcinoma cell line Also known as CWR22Rv1 or Rv1. Cells dsplay a NE (neuroendocrine phenotype). ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM., Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM. Cancer - Interactions investigated in the context of cancer included in coronavirus dataset as "Interactions between human proteins relevant for SARS-CoV2 infection have also been included". Cells were transfected with IKKE (IKBKE) anne-marie.mes-masson@umontreal.ca Accepted 2020-SEP-14 AT 07:03 BST AT 07:03 BST by ORCHARD Oncotarget 2017 Only protein-protein interactions imex curation imex curation IκB-Kinase-epsilon (IKKε) over-expression promotes the growth of prostate cancer through the C/EBP-β dependent activation of IL-6 gene expression. IκB-Kinase-epsilon (IKKε) over-expression promotes the growth of prostate cancer through the C/EBP-β dependent activation of IL-6 gene expression. Oncotarget 2017 imex curation Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM., Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM. Cancer - Interactions investigated in the context of cancer Coronavirus - Interactions investigated in the context of Coronavirus included in coronavirus dataset as "Interactions between human proteins relevant for SARS-CoV2 infection have also been included". anne-marie.mes-masson@umontreal.ca 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-22rv1 Homo sapiens 22rv1 Human prostate adenocarcinoma cell line Also known as CWR22Rv1 or Rv1. Cells dsplay a NE (neuroendocrine phenotype). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM., Péant B., Gilbert S., Le Page C., Poisson A., L'Ecuyer E., Boudhraa Z., Bienz MN., Delvoye N., Saad F., Mes-Masson AM. Cancer - Interactions investigated in the context of cancer included in coronavirus dataset as "Interactions between human proteins relevant for SARS-CoV2 infection have also been included". anne-marie.mes-masson@umontreal.ca Accepted 2020-SEP-14 AT 07:03 BST AT 07:03 BST by ORCHARD Oncotarget 2017 Only protein-protein interactions imex curation imex curation cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC DIP protein P17676 original sequence version: 102 9B725BD6CCAA771D ikke_human Inhibitor of nuclear factor kappa-B kinase subunit epsilon IKBKE IKKE IKKI KIAA0151 Inducible I kappa-B kinase protein protein human Homo sapiens Human MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFAETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCVLEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLGAGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV DIP protein Q14164 original sequence version: 139 DIP protein Q14164 original sequence version: 148 DIP protein Q14164 original sequence version: 108 3E5FBE5840734D81 il6_human_gene Interleukin-6 IL6 IFNB2 gene gene human Homo sapiens Human cebpb-il6-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7: 22727017 to 22727035 (+) 7: 22727172 to 22727192 (-) physical association physical association 4F doxycycline (CHEBI:50845 ) Dox-induced IKKe showed an increase of IL-6 endogenous promoter region occupancy by C/EBP-beta in 22Rv1-6TR-pTrexIKKe cells compared to the controls. cebpb-ikbke-1 2 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association 5A doxycycline (CHEBI:50845 )