IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-771s human-771S-patient renal carcinoma derived mouse xenografted cell line,parental Human 771s 771S-patient renal carcinoma derived mouse xenografted cell line,parental ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer Binding was weaker to all regions of the promoter region of lncARSR in the 7Su3rd cell line as compared to 786-O;FOXO1 binding was particularly weak. EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-771r human-771R-patient renal carcinoma derived mouse xenografted cell line,sunitinib-resistant Human 771r human-771R-patient renal carcinoma derived mouse xenografted cell line,sunitinib-resistant rna-ip rna immunoprecipitation rna-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer There is increased binding of hnRNPA2B1 to lncARSR in sunitinib-resistant cell lines ( 7Su3rd or 771R) relative to parental cells (786-o and 771S). EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap RIP-RNA immunoprecipitation The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer The sequence of the mutant " lncARSRmt(A2B1)" as given in "Plasmids construction" (Supplement p 49/50) is stated to have a mutation at residue 176 (T) - but the residue given for this residue in the unmutated sequence in Supp Fig 1L is also a "T". EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. rna-ip rna immunoprecipitation rna-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer ADD Causality statements when I have a useable identifier for LncARSR!! ADD lncARSRmt(miR-34/449) mutations for when have sequence.: then CLONE to cell line 771S EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap RIP- RNA immunoprecipitation The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line rna-ip rna immunoprecipitation rna-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-771r human-771R-patient renal carcinoma derived mouse xenografted cell line,sunitinib-resistant Human 771r human-771R-patient renal carcinoma derived mouse xenografted cell line,sunitinib-resistant ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer Binding was weaker to all regions of the promoter region of lncARSR in the 771R cell line as compared to 771S;FOXO1 binding was particularly weak. EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Exosome-Transmitted lncARSR Promotes Sunitinib Resistance in Renal Cancer by Acting as a Competing Endogenous RNA. Cancer cell 2016 imex curation Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Only protein-protein interactions imex curation human-771s human-771S-patient renal carcinoma derived mouse xenografted cell line,parental Human 771s 771S-patient renal carcinoma derived mouse xenografted cell line,parental rna-ip rna immunoprecipitation rna-ip q-pcr quantitative pcr q-pcr Qu L., Ding J., Chen C., Wu ZJ., Liu B., Gao Y., Chen W., Liu F., Sun W., Li XF., Wang X., Wang Y., Xu ZY., Gao L., Yang Q., Xu B., Li YM., Fang ZY., Xu ZP., Bao Y., Wu DS., Miao X., Sun HY., Sun YH., Wang HY., Wang LH. Cancer - Interactions investigated in the context of cancer There is increased binding of hnRNPA2B1 to lncARSR in sunitinib-resistant cell lines ( 7Su3rd or 771R) relative to parental cells (786-o and 771S). EMAIL was sent: 31/516 requesting a copyable sequence for Figure Supp 1L: but no reply - so I have COPIED ~first half of Supp Fig 1L to the sequence box- the rest of the sequence appears to be the same as much of ENST00000424980 (identifier given somewhere in this publication). If you can, please check I have entered the sequence correctly! for RNA identifier - Ensembl identifier ENST00000424980 has 328 bps. The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. (not clear where the 5' part of the sequence comes from - there are stated to be 4 exons in this transcript - but there ARE genomic matches to large regions of sequence in Supp Fig 1L. (I know as I blatted each line I copied in an attempt to see if I had copied it correctly.) So NO exact match with any Ensembl complete sequence though some overlap The sequence given for LNC ARSR has 591 bps as given in Supp Fig 1L. There is some overlap with the sequence given for Ensembl identifier ENST00000424980. wanglinhuicz@163.com,hywangk@vip.sina.com Accepted 2016-JUN-29 AT 08:46 BST AT 08:46 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation altered to Rna-IP; I have made a new "co-ip" experiments for cases when RNA is a Bait. Remaining ones now RNA-IP.; altered to Rna-IP; Sorry - I had not known that the CV term RNA-IP had now been added-corrected. I do not understand what you mean about the transcripts- I have added identifiers that are transcripts - with a "T" in the identifier already. I have copied over a "rem-internal" that should have been here, but was not. The problem is that e.g. ENST00000397752 - the sequence given in Ensembl for this identifier is DNA - not RNA, so it does not seem correct to enter as an "RNA molecule" in Intact, when the bases are from DNA not RNA - I am not sure if this is what you are referring to...? The links from UniProt for (ENST00000397752) MET to the link given "J02958 mRNA" also gives a DNA sequence in ENA, as do any of the other links I looked at. [Surely if we give an identifier as being of type "RNA" the identifier and any associated sequence should be RNA? (not DNA? -or why not give all protein sequences as DNA sequences as well!) ] On further thought:- I have taken the Ref-Seq sequence that corresponds to Ensembl transcript in question, as I can get a complete sequence without gobblety-gook in FASTA - which I cannot in Ensembl. All "T" s have been altered to "U"s. I have left both Ensembl and Ref_Seq identifiers as "see-also". I have altered the "Type" to RNA - as we now have "U"s not "T"s in the sequence. foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG DIP protein Q12778 original sequence version: 132 DIP protein Q12778 original sequence version: 84 6DEF6C994BDFDBAB lnc_arsr_human_gene gene gene human Homo sapiens Human roa2_human Heterogeneous nuclear ribonucleoproteins A2/B1 HNRNPA2B1 HNRPA2B1 protein protein human Homo sapiens Human MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY DIP protein P22626 original sequence version: 152 DIP protein P22626 original sequence version: 159 4C2560A3D8E99D62 leuk_human Leukosialin Galactoglycoprotein SPN CD43 Leukocyte sialoglycoprotein Sialophorin GPL115 protein protein human Homo sapiens Human MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP C9C9AB8435D5E1FE hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 9AA27B210730670C mir-449b mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human axl_transcript mrna messenger rna mRNA mrna human Homo sapiens Human GUGAGGGAAGGAGGCAGGGGUGCUGAGAAGGCGGCUGCUGGGCAGAGCCGGUGGCAAGGGCCUCCCCUGCCGCUGUGCCAGGCAGGCAGUGCCAAAUCCGGGGAGCCUGGAGCUGGGGGGAGGGCCGGGGACAGCCCGGCCCUGCCCCCUCCCCCGCUGGGAGCCCAACAACUUCUGAGGAAAGUUUGGCACCCAUGGCGUGGCGGUGCCCCAGGAUGGGCAGGGUCCCGCUGGCCUGGUGCUUGGCGCUGUGCGGCUGGGCGUGCAUGGCCCCCAGGGGCACGCAGGCUGAAGAAAGUCCCUUCGUGGGCAACCCAGGGAAUAUCACAGGUGCCCGGGGACUCACGGGCACCCUUCGGUGUCAGCUCCAGGUUCAGGGAGAGCCCCCCGAGGUACAUUGGCUUCGGGAUGGACAGAUCCUGGAGCUCGCGGACAGCACCCAGACCCAGGUGCCCCUGGGUGAGGAUGAACAGGAUGACUGGAUAGUGGUCAGCCAGCUCAGAAUCACCUCCCUGCAGCUUUCCGACACGGGACAGUACCAGUGUUUGGUGUUUCUGGGACAUCAGACCUUCGUGUCCCAGCCUGGCUAUGUUGGGCUGGAGGGCUUGCCUUACUUCCUGGAGGAGCCCGAAGACAGGACUGUGGCCGCCAACACCCCCUUCAACCUGAGCUGCCAAGCUCAGGGACCCCCAGAGCCCGUGGACCUACUCUGGCUCCAGGAUGCUGUCCCCCUGGCCACGGCUCCAGGUCACGGCCCCCAGCGCAGCCUGCAUGUUCCAGGGCUGAACAAGACAUCCUCUUUCUCCUGCGAAGCCCAUAACGCCAAGGGGGUCACCACAUCCCGCACAGCCACCAUCACAGUGCUCCCCCAGCAGCCCCGUAACCUCCACCUGGUCUCCCGCCAACCCACGGAGCUGGAGGUGGCUUGGACUCCAGGCCUGAGCGGCAUCUACCCCCUGACCCACUGCACCCUGCAGGCUGUGCUGUCAGACGAUGGGAUGGGCAUCCAGGCGGGAGAACCAGACCCCCCAGAGGAGCCCCUCACCUCGCAAGCAUCCGUGCCCCCCCAUCAGCUUCGGCUAGGCAGCCUCCAUCCUCACACCCCUUAUCACAUCCGCGUGGCAUGCACCAGCAGCCAGGGCCCCUCAUCCUGGACCCACUGGCUUCCUGUGGAGACGCCGGAGGGAGUGCCCCUGGGCCCCCCUGAGAACAUUAGUGCUACGCGGAAUGGGAGCCAGGCCUUCGUGCAUUGGCAAGAGCCCCGGGCGCCCCUGCAGGGUACCCUGUUAGGGUACCGGCUGGCGUAUCAAGGCCAGGACACCCCAGAGGUGCUAAUGGACAUAGGGCUAAGGCAAGAGGUGACCCUGGAGCUGCAGGGGGACGGGUCUGUGUCCAAUCUGACAGUGUGUGUGGCAGCCUACACUGCUGCUGGGGAUGGACCCUGGAGCCUCCCAGUACCCCUGGAGGCCUGGCGCCCAGGGCAAGCACAGCCAGUCCACCAGCUGGUGAAGGAACCUUCAACUCCUGCCUUCUCGUGGCCCUGGUGGUAUGUACUGCUAGGAGCAGUCGUGGCCGCUGCCUGUGUCCUCAUCUUGGCUCUCUUCCUUGUCCACCGGCGAAAGAAGGAGACCCGUUAUGGAGAAGUGUUUGAACCAACAGUGGAAAGAGGUGAACUGGUAGUCAGGUACCGCGUGCGCAAGUCCUACAGUCGUCGGACCACUGAAGCUACCUUGAACAGCCUGGGCAUCAGUGAAGAGCUGAAGGAGAAGCUGCGGGAUGUGAUGGUGGACCGGCACAAGGUGGCCCUGGGGAAGACUCUGGGAGAGGGAGAGUUUGGAGCUGUGAUGGAAGGCCAGCUCAACCAGGACGACUCCAUCCUCAAGGUGGCUGUGAAGACGAUGAAGAUUGCCAUCUGCACGAGGUCAGAGCUGGAGGAUUUCCUGAGUGAAGCGGUCUGCAUGAAGGAAUUUGACCAUCCCAACGUCAUGAGGCUCAUCGGUGUCUGUUUCCAGGGUUCUGAACGAGAGAGCUUCCCAGCACCUGUGGUCAUCUUACCUUUCAUGAAACAUGGAGACCUACACAGCUUCCUCCUCUAUUCCCGGCUCGGGGACCAGCCAGUGUACCUGCCCACUCAGAUGCUAGUGAAGUUCAUGGCAGACAUCGCCAGUGGCAUGGAGUAUCUGAGUACCAAGAGAUUCAUACACCGGGACCUGGCGGCCAGGAACUGCAUGCUGAAUGAGAACAUGUCCGUGUGUGUGGCGGACUUCGGGCUCUCCAAGAAGAUCUACAAUGGGGACUACUACCGCCAGGGACGUAUCGCCAAGAUGCCAGUCAAGUGGAUUGCCAUUGAGAGUCUAGCUGACCGUGUCUACACCAGCAAGAGCGAUGUGUGGUCCUUCGGGGUGACAAUGUGGGAGAUUGCCACAAGAGGCCAAACCCCAUAUCCGGGCGUGGAGAACAGCGAGAUUUAUGACUAUCUGCGCCAGGGAAAUCGCCUGAAGCAGCCUGCGGACUGUCUGGAUGGACUGUAUGCCUUGAUGUCGCGGUGCUGGGAGCUAAAUCCCCAGGACCGGCCAAGUUUUACAGAGCUGCGGGAAGAUUUGGAGAACACACUGAAGGCCUUGCCUCCUGCCCAGGAGCCUGACGAAAUCCUCUAUGUCAACAUGGAUGAGGGUGGAGGUUAUCCUGAACCCCCUGGAGCUGCAGGAGGAGCUGACCCCCCAACCCAGCCAGACCCUAAGGAUUCCUGUAGCUGCCUCACUGCGGCUGAGGUCCAUCCUGCUGGACGCUAUGUCCUCUGCCCUUCCACAACCCCUAGCCCCGCUCAGCCUGCUGAUAGGGGCUCCCCAGCAGCCCCAGGGCAGGAGGAUGGUGCCUGAGACAACCCUCCACCUGGUACUCCCUCUCAGGAUCCAAGCUAAGCACUGCCACUGGGGAAAACUCCACCUUCCCACUUUCCCACCCCACGCCUUAUCCCCACUUGCAGCCCUGUCUUCCUACCUAUCCCACCUCCAUCCCAGACAGGUCCCUCCCCUUCUCUGUGCAGUAGCAUCACCUUGAAAGCAGUAGCAUCACCAUCUGUAAAAGGAAGGGGUUGGAUUGCAAUAUCUGAAGCCCUCCCAGGUGUUAACAUUCCAAGACUCUAGAGUCCAAGGUUUAAAGAGUCUAGAUUCAAAGGUUCUAGGUUUCAAAGAUGCUGUGAGUCUUUGGUUCUAAGGACCUGAAAUUCCAAAGUCUCUAAUUCUAUUAAAGUGCUAAGGUUCUAAGGCCUACUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUGCGAUAGAGUCUCACUGUGUCACCCAGGCUGGAGUGCAGUGGUGCAAUCUCGCCUCACUGCAACCUUCACCUACCGAGUUCAAGUGAUUUUCCUGCCUUGGCCUCCCAAGUAGCUGGGAUUACAGGUGUGUGCCACCACACCCGGCUAAUUUUUAUAUUUUUAGUAGAGACAGGGUUUCACCAUGUUGGCCAGGCUGGUCUAAAACUCCUGACCUCAAGUGAUCUGCCCACCUCAGCCUCCCAAAGUGCUGAGAUUACAGGCAUGAGCCACUGCACUCAACCUUAAGACCUACUGUUCUAAAGCUCUGACAUUAUGUGGUUUUAGAUUUUCUGGUUCUAACAUUUUUGAUAAAGCCUCAAGGUUUUAGGUUCUAAAGUUCUAAGAUUCUGAUUUUAGGAGCUAAGGCUCUAUGAGUCUAGAUGUUUAUUCUUCUAGAGUUCAGAGUCCUUAAAAUGUAAGAUUAUAGAUUCUAAAGAUUCUAUAGUUCUAGACAUGGAGGUUCUAAGGCCUAGGAUUCUAAAAUGUGAUGUUCUAAGGCUCUGAGAGUCUAGAUUCUCUGGCUGUAAGGCUCUAGAUCAUAAGGCUUCAAAAUGUUAUCUUCUCAAGUUCUAAGAUUCUAAUGAUGAUCAAUUAUAGUUUCUGAGGCUUUAUGAUAAUAGAUUCUCUUGUAUAAGAUCCUAGAUCCUAAGGGUCGAAAGCUCUAGAAUCUGCAAUUCAAAAGUUCCAAGAGUCUAAAGAUGGAGUUUCUAAGGUCCGGUGUUCUAAGAUGUGAUAUUCUAAGACUUACUCUAAGAUCUUAGAUUCUCUGUGUCUAAGAUUCUAGAUCAGAUGCUCCAAGAUUCUAGAUGAUUAAAUAAGAUUCUAACGGUCUGUUCUGUUUCAAGGCACUCUAGAUUCCAUUGGUCCAAGAUUCCGGAUCCUAAGCAUCUAAGUUAUAAGACUCUCACACUCAGUUGUGACUAACUAGACACCAAAGUUCUAAUAAUUUCUAAUGUUGGACACCUUUAGGUUCUUUGCUGCAUUCUGCCUCUCUAGGACCAUGGUUAAGAGUCCAAGAAUCCACAUUUCUAAAAUCUUAUAGUUCUAGGCACUGUAGUUCUAAGACUCAAAUGUUCUAAGUUUCUAAGAUUCUAAAGGUCCACAGGUCUAGACUAUUAGGUGCAAUUUCAAGGUUCUAACCCUAUACUGUAGUAUUCUUUGGGGUGCCCCUCUCCUUCUUAGCUAUCAUUGCUUCCUCCUCCCCAACUGUGGGGGUGUGCCCCCUUCAAGCCUGUGCAAUGCAUUAGGGAUGCCUCCUUUCCCGCAGGGGAUGGACGAUCUCCCACCUUUCGGGCCAUGUUGCCCCCGUGAGCCAAUCCCUCACCUUCUGAGUACAGAGUGUGGACUCUGGUGCCUCCAGAGGGGCUCAGGUCACAUAAAACUUUGUAUAUCAACGAGAAAAAAAA ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q9UKV8 original sequence version: 1(def) DIP protein Q9UKV8 original sequence version: 44 DIP protein Q9UKV8 original sequence version: 60 DIP protein Q9UKV8 original sequence version: 62 DIP protein Q9UKV8 original sequence version: 89 DIP protein Q9UKV8 original sequence version: 85 DIP protein Q9UKV8 original sequence version: 87 DIP protein Q9UKV8 original sequence version: 99 DIP protein Q9UKV8 original sequence version: 117 DIP protein Q9UKV8-1 original sequence version: 117 DIP protein Q9UKV8 original sequence version: 145 DIP protein Q9UKV8 original sequence version: 108 5C8552C43FC81345 mir-34b-5p mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human mir-34c-5p mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 mir-34a-3p mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human mir-449c-5p mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human met_transcript mrna messenger rna mRNA mrna human Homo sapiens Human GAAUUCCGCCCUCGCCGCCCGCGGCGCCCCGAGCGCUUUGUGAGCAGAUGCGGAGCCGAGUGGAGGGCGCGAGCCAGAUGCGGGGCGACAGCUGACUUGCUGAGAGGAGGCGGGGAGGCGCGGAGCGCGCGUGUGGUCCUUGCGCCGCUGACUUCUCCACUGGUUCCUGGGCACCGAAAGAUAAACCUCUCAUAAUGAAGGCCCCCGCUGUGCUUGCACCUGGCAUCCUCGUGCUCCUGUUUACCUUGGUGCAGAGGAGCAAUGGGGAGUGUAAAGAGGCACUAGCAAAGUCCGAGAUGAAUGUGAAUAUGAAGUAUCAGCUUCCCAACUUCACCGCGGAAACACCCAUCCAGAAUGUCAUUCUACAUGAGCAUCACAUUUUCCUUGGUGCCACUAACUACAUUUAUGUUUUAAAUGAGGAAGACCUUCAGAAGGUUGCUGAGUACAAGACUGGGCCUGUGCUGGAACACCCAGAUUGUUUCCCAUGUCAGGACUGCAGCAGCAAAGCCAAUUUAUCAGGAGGUGUUUGGAAAGAUAACAUCAACAUGGCUCUAGUUGUCGACACCUACUAUGAUGAUCAACUCAUUAGCUGUGGCAGCGUCAACAGAGGGACCUGCCAGCGACAUGUCUUUCCCCACAAUCAUACUGCUGACAUACAGUCGGAGGUUCACUGCAUAUUCUCCCCACAGAUAGAAGAGCCCAGCCAGUGUCCUGACUGUGUGGUGAGCGCCCUGGGAGCCAAAGUCCUUUCAUCUGUAAAGGACCGGUUCAUCAACUUCUUUGUAGGCAAUACCAUAAAUUCUUCUUAUUUCCCAGAUCAUCCAUUGCAUUCGAUAUCAGUGAGAAGGCUAAAGGAAACGAAAGAUGGUUUUAUGUUUUUGACGGACCAGUCCUACAUUGAUGUUUUACCUGAGUUCAGAGAUUCUUACCCCAUUAAGUAUGUCCAUGCCUUUGAAAGCAACAAUUUUAUUUACUUCUUGACGGUCCAAAGGGAAACUCUGAAACUCUAGAUGCUCAGACUUUUCACACAAGAAUAAUCAGGUUCUGUUCCAUAAACUCUGGAUUGCAUUCCUACAUGGAAAUGCCUCUGGAGUGUAUUCUCACAGAAAAGAGAAAAAAGAGAUCCACAAAGAAGGAAGUGUUUAAUAUACUUCAGGCUGCGUAUGUCAGCAAGCCUGGGGCCCAGCUUGCUAGACAAAUAGGAGCCAGCCUGAAUGAUGACAUUCUUUUCGGGGUGUUCGCACAAAGCAAGCCAGAUUCUGCCGAACCAAUGGAUCGAUCUGCCAUGUGUGCAUUCCCUAUCAAAUAUGUCAACGACUUCUUCAACAAGAUCGUCAACAAAAACAAUGUGAGAUGUCUCCAGCAUUUUUACGGACCCAAUCAUGAGCACUGCUUUAAUAGGACACUUCUGAGAAAUUCAUCAGGCUGUGAAGCGCGCCGUGAUGAAUAUCGAACAGAGUUUACCACAGCUUUGCAGCGCGUUGACUUAUUCAUGGGUCAAUUCAGCGAAGUCCUCUUAACAUCUAUAUCCACCUUCAUUAAAGGAGACCUCACCAUAGCUAAUCUUGGGACAUCAGAGGGUCGCUUCAUGCAGGUUGUGGUUUCUCGAUCAGGACCAUCAACCCCUCAUGUGAAUUUUCUCCUGGACUCCCAUCCAGUGUCUCCAGAAGUGAUUGUGGAGCAUACAUUAAACCAAAAUGGCUACACACUGGUUAUCACUGGGAAGAAGAUCACGAAGAUCCCAUUGAAUGGCUUGGGCUGCAGACAUUUCCAGUCCUGCAGUCAAUGCCUCUCUGCCCCACCCUUUGUUCAGUGUGGCUGGUGCCACGACAAAUGUGUGCGAUCGGAGGAAUGCCUGAGCGGGACAUGGACUCAACAGAUCUGUCUGCCUGCAAUCUACAAGGUUUUCCCAAAUAGUGCACCCCUUGAAGGAGGGACAAGGCUGACCAUAUGUGGCUGGGACUUUGGAUUUCGGAGGAAUAAUAAAUUUGAUUUAAAGAAAACUAGAGUUCUCCUUGGAAAUGAGAGCUGCACCUUGACUUUAAGUGAGAGCACGAUGAAUACAUUGAAAUGCACAGUUGGUCCUGCCAUGAAUAAGCAUUUCAAUAUGUCCAUAAUUAUUUCAAAUGGCCACGGGACAACACAAUACAGUACAUUCUCCUAUGUGGAUCCUGUAAUAACAAGUAUUUCGCCGAAAUACGGUCCUAUGGCUGGUGGCACUUUACUUACUUUAACUGGAAAUUACCUAAACAGUGGGAAUUCUAGACACAUUUCAAUUGGUGGAAAAACAUGUACUUUAAAAAGUGUGUCAAACAGUAUUCUUGAAUGUUAUACCCCAGCCCAAACCAUUUCAACUGAGUUUGCUGUUAAAUUGAAAAUUGACUUAGCCAACCGAGAGACAAGCAUCUUCAGUUACCGUGAAGAUCCCAUUGUCUAUGAAAUUCAUCCAACCAAAUCUUUUAUUAGUGGUGGGAGCACAAUAACAGGUGUUGGGAAAAACCUGAAUUCAGUUAGUGUCCCGAGAAUGGUCAUAAAUGUGCAUGAAGCAGGAAGGAACUUUACAGUGGCAUGUCAACAUCGCUCUAAUUCAGAGAUAAUCUGUUGUACCACUCCUUCCCUGCAACAGCUGAAUCUGCAACUCCCCCUGAAAACCAAAGCCUUUUUCAUGUUAGAUGGGAUCCUUUCCAAAUACUUUGAUCUCAUUUAUGUACAUAAUCCUGUGUUUAAGCCUUUUGAAAAGCCAGUGAUGAUCUCAAUGGGCAAUGAAAAUGUACUGGAAAUUAAGGGAAAUGAUAUUGACCCUGAAGCAGUUAAAGGUGAAGUGUUAAAAGUUGGAAAUAAGAGCUGUGAGAAUAUACACUUACAUUCUGAAGCCGUUUUAUGCACGGUCCCCAAUGACCUGCUGAAAUUGAACAGCGAGCUAAAUAUAGAGUGGAAGCAAGCAAUUUCUUCAACCGUCCUUGGAAAAGUAAUAGUUCAACCAGAUCAGAAUUUCACAGGAUUGAUUGCUGGUGUUGUCUCAAUAUCAACAGCACUGUUAUUACUACUUGGGUUUUUCCUGUGGCUGAAAAAGAGAAAGCAAAUUAAAGAUCUGGGCAGUGAAUUAGUUCGCUACGAUGCAAGAGUACACACUCCUCAUUUGGAUAGGCUUGUAAGUGCCCGAAGUGUAAGCCCAACUACAGAAAUGGUUUCAAAUGAAUCUGUAGACUACCGAGCUACUUUUCCAGAAGAUCAGUUUCCUAAUUCAUCUCAGAACGGUUCAUGCCGACAAGUGCAGUAUCCUCUGACAGACAUGUCCCCCAUCCUAACUAGUGGGGACUCUGAUAUAUCCAGUCCAUUACUGCAAAAUACUGUCCACAUUGACCUCAGUGCUCUAAAUCCAGAGCUGGUCCAGGCAGUGCAGCAUGUAGUGAUUGGGCCCAGUAGCCUGAUUGUGCAUUUCAAUGAAGUCAUAGGAAGAGGGCAUUUUGGUUGUGUAUAUCAUGGGACUUUGUUGGACAAUGAUGGCAAGAAAAUUCACUGUGCUGUGAAAUCCUUGAACAGAAUCACUGACAUAGGAGAAGUUUCCCAAUUUCUGACCGAGGGAAUCAUCAUGAAAGAUUUUAGUCAUCCCAAUGUCCUCUCGCUCCUGGGAAUCUGCCUGCGAAGUGAAGGGUCUCCGCUGGUGGUCCUACCAUACAUGAAACAUGGAGAUCUUCGAAAUUUCAUUCGAAAUGAGACUCAUAAUCCAACUGUAAAAGAUCUUAUUGGCUUUGGUCUUCAAGUAGCCAAAGGCAUGAAAUAUCUUGCAAGCAAAAAGUUUGUCCACAGAGACUUGGCUGCAAGAAACUGUAUGCUGGAUGAAAAAUUCACAGUCAAGGUUGCUGAUUUUGGUCUUGCCAGAGACAUGUAUGAUAAAGAAUACUAUAGUGUACACAACAAAACAGGUGCAAAGCUGCCAGUGAAGUGGAUGGCUUUGGAAAGUCUGCAAACUCAAAAGUUUACCACCAAGUCAGAUGUGUGGUCCUUUGGCGUGCUCCUCUGGGAGCUGAUGACAAGAGGAGCCCCACCUUAUCCUGACGUAAACACCUUUGAUAUAACUGUUUACUUGUUGCAAGGGAGAAGACUCCUACAACCCGAAUACUGCCCAGACCCCUUAUAUGAAGUAAUGCUAAAAUGCUGGCACCCUAAAGCCGAAAUGCGCCCAUCCUUUUCUGAACUGGUGUCCCGGAUAUCAGCGAUCUUCUCUACUUUCAUUGGGGAGCACUAUGUCCAUGUGAACGCUACUUAUGUGAACGUAAAAUGUGUCGCUCCGUAUCCUUCUCUGUUGUCAUCAGAAGAUAACGCUGAUGAUGAGGUGGACACACGACCAGCCUCCUUCUGGGAGACAUCAUAGUGCUAGUACUAUGUCAAAGCAACAGUCCACACUUUGUCCAAUGGUUUUUUCACUGCCUGACCUUUAAAAGGCCAUCGAUAUUCUUUGCUCUUGCCAAAAUUGCACUAUUAUAGGACUUGUAUUGUUAUUUAAAUUACUGGAUUCUAAGGAAUUUCUUAUCUGACAGAGCAUCAGAACCAGAGGCUUGGUCCCACAGGCCACGGACCAAUGGCCUGCAGCCGUGACAACACUCCUGUCAUAUUGGAGUCCAAAACUUGAAUUCUGGGUUGAAUUUUUUAAAAAUCAGGUACCACUUGAUUUCAUAUGGGAAAUUGAAGCAGGAAAUAUUGAGGGCUUCUUGAUCACAGAAAACUCAGAAGAGAUAGUAAUGCUCAGGACAGGAGCGGCAGCCCCAGAACAGGCCACUCAUUUAGAAUUCUAGUGUUUCAAAACACUUUUGUGUGUUGUAUGGUCAAUAACAUUUUUCAUUACUGAUGGUGUCAUUCACCCAUUAGGUAAACAUUCCCUUUUAAAUGUUUGUUUGUUUUUUGAGACAGGAUCUCACUCUGUUGCCAGGGCUGUAGUGCAGUGGUGUGAUCAUAGCUCACUGCAACCUCCACCUCCCAGGCUCAAGCCUCCCGAAUAGCUGGGACUACAGGCGCACACCACCAUCCCCGGCUAAUUUUUGUAUUUUUUGUAGAGACGGGGUUUUGCCAUGUUGCCAAGGCUGGUUUCAAACUCCUGGACUCAAGAAAUCCACCCACCUCAGCCUCCCAAAGUGCUAGGAUUACAGGCAUGAGCCACUGCGCCCAGCCCUUAUAAAUUUUUGUAUAGACAUUCCUUUGGUUGGAAGAAUAUUUAUAGGCAAUACAGUCAAAGUUUCAAAAUAGCAUCACACAAAACAUGUUUAUAAAUGAACAGGAUGUAAUGUACAUAGAUGACAUUAAGAAAAUUUGUAUGAAAUAAUUUAGUCAUCAUGAAAUAUUUAGUUGUCAUAUAAAAACCCACUGUUUGAGAAUGAUGCUACUCUGAUCUAAUGAAUGUGAACAUGUAGAUGUUUUGUGUGUAUUUUUUUAAAUGAAAACUCAAAAUAAGACAAGUAAUUUGUUGAUAAAUAUUUUUAAAGAUAACUCAGCAUGUUUGUAAAGCAGGAUACAUUUUACUAAAAGGUUCAUUGGUUCCAAUCACAGCUCAUAGGUAGAGCAAAGAAAGGGUGGAUGGAUUGAAAAGAUUAGCCUCUGUCUCGGUGGCAGGUUCCCACCUCGCAAGCAAUUGGAAACAAAACUUUUGGGGAGUUUUAUUUUGCAUUAGGGUGUGUUUUAUGUUAAGCAAAACAUACUUUAGAAACAAAUGAAAAAGGCAAUUGAAAAUCCCAGCUAUUUCACCUAGAUGGAAUAGCCACCCUGAGCAGAACUUUGUGAUGCUUCAUUCUGUGGAAUUUUGUGCUUGCUACUGUAUAGUGCAUGUGGUGUAGGUUACUCUAACUGGUUUUGUCGACGUAAACAUUUAAAGUGUUAUAUUUUUUAUAAAAAUGUUUAUUUUUAAUGAUAUGAGAAAAAUUUUGUUAGGCCACAAAAACACUGCACUGUGAACAUUUUAGAAAAGGUAUGUCAGACUGGGAUUAAUGACAGCAUGAUUUUCAAUGACUGUAAAUUGCGAUAAGGAAAUGUACUGAUUGCCAAUACACCCCACCCUCAUUACAUCAUCAGGACUUGAAGCCAAGGGUUAACCCAGCAAGCUACAAAGAGGGUGUGUCACACUGAAACUCAAUAGUUGAGUUUGGCUGUUGUUGCAGGAAAAUGAUUAUAACUAAAAGCUCUCUGAUAGUGCAGAGACUUACCAGAAGACACAAGGAAUUGUACUGAAGAGCUAUUACAAUCCAAAUAUUGCCGUUUCAUAAAUGUAAUAAGUAAUACUAAUUCACAGAGUAUUGUAAAUGGUGGAUGACAAAAGAAAAUCUGCUCUGUGGAAAGAAAGAACUGUCUCUACCAGGGUCAAGAGCAUGAACGCAUCAAUAGAAAGAACUCGGGGAAACAUCCCAUCAACAGGACUACACACUUGUAUAUACAUUCUUGAGAACACUGCAAUGUGAAAAUCACGUUUGCUAUUUAUAAACUUGUCCUUAGAUUAAUGUGUCUGGACAGAUUGUGGGAGUAAGUGAUUCUUCUAAGAAUUAGAUACUUGUCACUGCCUAUACCUGCAGCUGAACUGAAUGGUACUUCGUAUGUUAAUAGUUGUUCUGAUAAAUCAUGCAAUUAAAGUAAAGUGAUGCAACAUCUUGUAAAAAAAAAAAAAAAAAAAA mir-34a-5p mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human mir-449a mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA human Homo sapiens Human vps36_human Vacuolar protein-sorting-associated protein 36 VPS36 C13orf9 EAP45 ELL-associated protein of 45 kDa ESCRT-II complex subunit VPS36 CGI-145 protein protein human Homo sapiens Human MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS DIP protein Q86VN1 original sequence version: 33 21E1E66F71BA7764 lnc_arsr lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human ACCCCCGGAGGCACUCGGAGAGAAAGCGCAUCCCGACGCUCCAUCGGGGGUCGCGGGGGGCAGUAACCGUGGGGGCUCCGGGUGGGGCUGAAGAUCCGGGAAUCAGAGACGCUGGACCUCCAAAGAAACUUUGCCGACUGGGCCACGUGAACCCCGAACACGGAUUAUUGAACCCUAUUAUGGCAGACACUAUUCUAGUUGCUGGGAAUACAGCUGUGGAUGGGCAAGGCAAGGUCCCUGUUCUUAUGGAGCUAGCACUGAGGUGCAAGCCCAGAGGCAGUCUAUACCCCAACUCAACUGGCUGGUCUCAAAUGCUGCCUGCUUCCGUGCCCAACUUAGAACUACACAUCUGCUGCCUCUUGGUAACAUGUCAUUAUAAGUCUGAAGAUUGCCAUUUGAAAUGCUCUUUGAGGGAUGCGAAGUCAACCCUGGAUCCAAAGUAGCUUUGAUGUUUGUCAGGAAAAUGCUGGAAUUCUAUACACUACAGUUUCUACAGAGCAUGAAGAACUCCAACUUCAGACAACCUGCAAAAAAAGUCAGAGAGCAAUUAAAUAUAAAAAUAAAUUCCUUUGAUAAAACAAAAAAAAAAAA foxo3_human Forkhead box protein O3 FOXO3 FKHRL1 FOXO3A Forkhead in rhabdomyosarcoma-like 1 AF6q21 protein protein protein human Homo sapiens Human MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG E5B4E830665A9982 DIP protein O43524 original sequence version: 82 E5B4E830665A9982 cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 85AC8E235C6E425F tsn8_human Tetraspanin-8 TSPAN8 TM4SF3 Transmembrane 4 superfamily member 3 Tumor-associated antigen CO-029 protein protein human Homo sapiens Human MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK D1058F054EE8C14E foxo1-lnc_arsr_human_gene-1 3 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role bait bait association association 1Gi foxo1-lnc_arsr_human_gene-2 4 12 unspecified role unspecified role prey prey promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association 1G foxo3-lnc_arsr_human_gene-1 4 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role bait bait association association 1Gi foxo1-lnc_arsr_human_gene-4 3 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association 1G 124124-1 6 30 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 27 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 31 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 13 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 14 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 21 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 15 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association 3D cytoplasmic lysates of 7Su3rd cells. lnc_arsr-cd63-1 6 13 unspecified role unspecified role prey prey human-7Su3rd human 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O cell line Human 7su3rd 7Su3rd- xenografted sunitinib-resistant cells from parental 786-O human cell line 28 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A9T,G10A,C12T,A19T,G20A,A21G,G22A,C175A,A177T,C236A,T239A,G240T,G249C, G251C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C T certain certain sequence position certain certain certain sequence position certain AG TA certain certain sequence position certain certain certain sequence position certain AGAG TAGT certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain A T certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain TG AT certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain G C in vitro In vitro physical association physical association 3E lnc_arsr-hnrnpa2b1-1 7 13 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 3 G There is increased binding of hnRNPA2B1 to lncARSR in sunitinib-resistant cell lines ( 7Su3rd or 771R) relative to parental cells (786-o and 771S). hnrnpa2b1-lnc_arsr-1 8 13 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 3 F/G There is increased binding of hnRNPA2B1 to lncARSR in sunitinib-resistant cell lines ( 7Su3rd or 771R) relative to parental cells (786-o and 771S). hnrnpa2b1-lnc_arsr-2 10 13 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 3 G hnrnpa2b1-lnc_arsr-3 5 13 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 3 G hnrnpa2b1-lnc_arsr-4 7 18 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 6A ago2-lnc_arsr-1 7 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association 6Ai Lnc ARSR ago2-axl_transcript-1 7 18 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey association association 6Aii LncARSR ago2-lnc_arsr-2 8 18 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association 6A ago2-met_transcript-1 8 18 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey association association 6Aii LncARSR siRNA ago2-axl_transcript-2 8 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association 6Ai Lnc ARSR siRNA mir_34a_3p-lnc_arsr-1 7 22 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B mir_34a_3p-lnc_arsr-2 7 25 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-2 mir_34a_5p-lnc_arsr-1 7 19 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-3 mir_34a_5p-lnc_arsr-2 7 20 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-4 mir_449a-lnc_arsr-1 7 16 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-5 mir_449a-lnc_arsr-2 7 26 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-6 mir_449a-lnc_arsr-3 7 23 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-7 foxo1-lnc_arsr_human_gene-3 2 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Supp 1T foxo3-lnc_arsr_human_gene-2 2 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role bait bait association association Supp 1T foxo1-lnc_arsr_human_gene-5 9 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait association association Supp 1T foxo3-lnc_arsr_human_gene-3 9 12 unspecified role unspecified role prey prey promoter_region_P1 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P2 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined promoter_region_P3 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role bait bait association association Supp 1T mir_34a_3p-lnc_arsr-3 1 22 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B mir_34b_5p-lnc_arsr-1 1 19 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-3 mir_34c_5p-lnc_arsr-1 1 20 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-4 mir_34a_5p-lnc_arsr-3 1 25 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-2 mir_449b-lnc_arsr-1 1 16 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-5 mir_449a-lnc_arsr-4 1 26 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-6 mir_449c_5p-lnc_arsr-1 1 23 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 28 unspecified role unspecified role prey prey association association 6B-7