IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay sequence tag sequence tag identification sequence tag Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Phosphorylation of ETS1 by Src Family Kinases Prevents Its Recognition by the COP1 Tumor Suppressor. Cancer Cell (1535-6108) 2014 imex curation Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. william_kaelin@dfci.harvard.edu 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu G., Zhang Q., Huang Y., Song J., Tomaino R., Ehrenberger T., Lim E., Liu W., Bronson R.T., Bowden M., Brock J., Krop I.E., Dillon D.A., Gygi S.P., Mills G.B., Richardson A.L., Signoretti S., Yaffe M.B., Kaelin W.G. Cancer - Interactions investigated in the context of cancer I have not added fig 1F,2C - In Vitro Ubiquitination, as it is measuring ubiq. of ETS2 - a PTM only here, and also COP1 (E3 source) is from a not very purified IP. An anti-FLAG antibody was used for IP. william_kaelin@dfci.harvard.edu Accepted 2014-SEP-15 by ORCHARD Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation etv1_human ETS translocation variant 1 ETV1 ER81 Ets-related protein 81 protein protein human Homo sapiens Human MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY DIP protein P50549 original sequence version: 102 BE95FA3F07196F06 mvp_human Major vault protein MVP LRP Lung resistance-related protein protein protein human Homo sapiens Human MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGDEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGPEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKDPQETAKLFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQNGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEKARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELELVYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPINLFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR 6FEE5545B0A3FE65 ets2_human Protein C-ets-2 ETS2 protein protein human Homo sapiens Human MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED DIP protein P15036 original sequence version: 158 5944EC4B5AAB553E dda1_human DET1- and DDB1-associated protein 1 DDA1 C19orf58 PCIA1 Placenta cross-immune reaction antigen 1 protein protein human Homo sapiens Human MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAKKRDQEQVELEGESSAPPRKVARTDSPDMHEDT DIP protein Q9BW61 original sequence version: 72 94E43C3528589F01 cul4a_human Cullin-4A CUL4A protein protein human Homo sapiens Human MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRTHIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLTAILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA DIP protein Q13619 original sequence version: 136 DIP protein Q13619 original sequence version: 131 DIP protein Q13619 original sequence version: 129 DIP protein Q13619 original sequence version: 87 DIP protein Q13619 original sequence version: 104 DIP protein Q13619 original sequence version: 151 DIP protein Q13619 original sequence version: 111 DIP protein Q13619 original sequence version: 140 3C4C6A1BBD94D51B parp4_human Protein mono-ADP-ribosyltransferase PARP4 ADPRTL1 KIAA0177 PARPL 193 kDa vault protein PARP-related/IalphaI-related H5/proline-rich Vault poly(ADP-ribose) polymerase PARP4 ADP-ribosyltransferase diphtheria toxin-like 4 Poly [ADP-ribose] polymerase 4 protein protein human Homo sapiens Human MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQLNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCPDSATEEEDTVELTEFGMQNVEIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDSRDCPFLISSHFLLDDGMETRRQFAIKKTSEDASEYFENYIEELKKQGFLLREHFTPEATQLASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGILLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVCETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGRVNETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFEDDEFVVYKTNQVKMKYIIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVEDYQLPDAKTSSSTKAGLQDASGNLVPLEDVHIKGRIIDTVAQVIVFQTYTNKSHVPIEAKYIFPLDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQGHGAYLMSQDAPDVFTVSVGNLPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVEKICIKEIGTKQSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYLPRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIALHALSLVGEKQKVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRYLSLLYPARGSRNILLVSDGHLQDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCGAGVFEYFNAKSKHSWRKQIEDQMTRLCSPSCHSVSVKWQQLNPDVPEALQAPAQVPSLFLNDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTTGTMIHKLAARALIRDYEDGILHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAKEDVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSEDFEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILAPAVGSYLPPTARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQSASCPTGPPQNPPSSPYCGIVFSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFSLPTDPDPIRGFGSYHPSASSPFHFQPSAASLTANLRLPMASALPEALCSQSRTTPVDLCLLEESVGSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQIKCDTKDDSILCFLEVKEEDEIVCIQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGRECLLDLIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTEGQYPSICPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG DCA1DD4C001EA22F src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P12931 original sequence version: 188 DIP protein P12931 original sequence version: 189 DIP protein P12931 original sequence version: 190 DIP protein P12931 original sequence version: 191 DIP protein P12931 original sequence version: 115 DIP protein P12931 original sequence version: 116 DIP protein P12931 original sequence version: 164 DIP protein P12931 original sequence version: 142 DIP protein P12931 original sequence version: 143 DIP protein P12931 original sequence version: 150 DIP protein P12931 original sequence version: 160 DIP protein P12931 original sequence version: 184 DIP protein P12931 original sequence version: 155 DIP protein P12931-1 original sequence version: 155 DIP protein P12931 original sequence version: 202 C1908084683E5DE8 etv5_human ETS translocation variant 5 ETV5 ERM Ets-related protein ERM protein protein human Homo sapiens Human MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY B7CE40A33927F46E q8nhy2-1 E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 homolog RFWD2 RING finger and WD repeat domain protein 2 RING finger protein 200 RING-type E3 ubiquitin transferase RFWD2 RNF200 protein protein human Homo sapiens Human MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV DIP protein Q8NHY2-1 original sequence version: 81 C4B262268D01FA00 p14921-1 Protein C-ets-1 ETS1 EWSR2 p54 Ets-1 p51 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE 3B66BCC464B393FB det1_human DET1 homolog DET1 De-etiolated-1 homolog protein protein human Homo sapiens Human MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIHVFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLLVYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPSQASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQIQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYVVNFHMRHCCT A164AC844F897DF7 trib1_human Tribbles homolog 1 SKIP1 G-protein-coupled receptor-induced gene 2 protein TRIB1 C8FW GIG2 TRB1 protein protein human Homo sapiens Human MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSFFC 5F54E50924B1365B etv4_human ETS translocation variant 4 Adenovirus E1A enhancer-binding protein E1A-F E1AF PEA3 Polyomavirus enhancer activator 3 homolog ETV4 protein protein human Homo sapiens Human MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY BA9864F3C690A8C1 junb_human Transcription factor jun-B JUNB protein protein human Homo sapiens Human MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF DIP protein P17275 original sequence version: 151 DIP protein P17275 original sequence version: 118 DIP protein P17275 original sequence version: 143 DF8CD1CD4409C6BE cop1_human E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 homolog RFWD2 RING finger and WD repeat domain protein 2 RING finger protein 200 RING-type E3 ubiquitin transferase RFWD2 RNF200 protein protein human Homo sapiens Human MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV DIP protein Q8NHY2 original sequence version: 81 C4B262268D01FA00 ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE DIP protein P14921 original sequence version: 175 3B66BCC464B393FB ddb1_human DNA damage-binding protein 1 DDB1 Damage-specific DNA-binding protein 1 UV-damaged DNA-binding factor DDB p127 subunit DNA damage-binding protein a UV-damaged DNA-binding protein 1 Xeroderma pigmentosum group E-complementing protein XPE-binding factor HBV X-associated protein 1 XAP1 protein protein human Homo sapiens Human MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH DIP protein Q16531 original sequence version: 145 DIP protein Q16531 original sequence version: 140 DIP protein Q16531 original sequence version: 99 DIP protein Q16531 original sequence version: 93 DIP protein Q16531 original sequence version: 116 DIP protein Q16531 original sequence version: 111 DIP protein Q16531-1 original sequence version: 163 DIP protein Q16531 original sequence version: 162 DIP protein Q16531 original sequence version: 113 DIP protein Q16531 original sequence version: 132 DIP protein Q16531 original sequence version: 139 DIP protein Q16531 original sequence version: 151 DIP protein Q16531-1 original sequence version: 144 DIP protein Q16531 original sequence version: 155 74D082023E3D846D trib3_human Tribbles homolog 3 Neuronal cell death-inducible putative kinase p65-interacting inhibitor of NF-kappa-B SINK TRIB3 C20orf97 NIPK SKIP3 TRB3 protein protein human Homo sapiens Human MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG CE15FD89A81E8D63 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 rfwd2-dda1 6 19 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Figure 1A/B rfwd2-cul4a 8 19 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Figure 1C ets2-rfwd2 7 23 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P15036:p.Val52_Pro53delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:15:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val52ala,pro53ala Fri Jul 22 11:06:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val52ala,pro53ala' Wed May 02 15:53:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro52-53ala_ala' Tue Jun 30 19:43:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val52_Pro53delinsAlaAla' P15036:p.Val308_Pro309delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:15:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val308ala,pro309ala Fri Jul 22 10:58:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val308ala,pro309ala' Wed May 02 17:16:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro308-309ala_ala' Tue Jun 30 18:00:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val308_Pro309delinsAlaAla' P15036:p.[Val52_Pro53delinsAlaAla;Val308_Pro309delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VP AA certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:15:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val52ala,pro53ala,val308ala,pro309ala Fri Jul 22 11:07:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val52ala,pro53ala,val308ala,pro309ala' Wed May 02 17:25:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro52-53ala_ala,val_pro308-309ala_ala' Tue Jun 30 17:11:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val52_Pro53delinsAlaAla;Val308_Pro309delinsAlaAla]' physical association physical association 2D ets1-rfwd2 2 23 unspecified role unspecified role prey prey human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line 18 unspecified role unspecified role bait bait ser276,ser282 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P14921-1:p.Val280_Pro281delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:18:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val280ala,pro281ala Fri Jul 22 11:01:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val280ala,pro281ala' Wed May 02 19:28:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro280-281ala_ala' Tue Jun 30 19:37:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val280_Pro281delinsAlaAla' degron sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser276 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain ser282 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain tyr283 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 3A Phosphorylation of either serine residue enhanced the binding to COP1; tyrosine phosphorylation decreased binding to COP1 by itself and when combined with phosphorylation of the serine corresponding to Ser282. ets1-rfwd2-3 7 18 unspecified role unspecified role bait bait P14921-1:p.Ser282_Tyr283delinsAlaPhe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain SY AF Thu Jul 07 12:17:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser282ala,tyr283phe Fri Jul 22 11:13:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser282ala,tyr283phe' Wed May 02 15:13:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr282-283ala_phe' Tue Jun 30 20:17:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser282_Tyr283delinsAlaPhe' P14921-1:p.[Ser276Ala;Ser282_Tyr283delinsAspPhe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain SY DF Thu Jul 07 12:17:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser276ala,ser282asp,tyr283phe Fri Jul 22 10:58:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276ala,ser282asp,tyr283phe' Wed May 02 14:30:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276ala,ser_tyr282-283asp_phe' Tue Jun 30 17:15:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser276Ala;Ser282_Tyr283delinsAspPhe]' P14921-1:p.[Ser276Asp;Tyr283Phe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 20:18:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276asp,tyr283phe' Tue Jun 30 17:59:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser276Asp;Tyr283Phe]' P14921-1:p.[Ser276Asp;Ser282_Tyr283delinsAspPhe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain SY DF certain certain sequence position certain certain certain sequence position certain S D Thu Jul 07 12:17:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser276asp,ser282ala,tyr283phe Fri Jul 22 10:57:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276asp,ser282ala,tyr283phe' Wed May 02 19:10:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276asp,ser_tyr282-283asp_phe' Tue Jun 30 19:53:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser276Asp;Ser282_Tyr283delinsAspPhe]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P14921-1:p.Val280_Pro281delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:17:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val280ala,pro281ala Fri Jul 22 11:01:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val280ala,pro281ala' Wed May 02 14:44:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro280-281ala_ala' Tue Jun 30 19:39:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val280_Pro281delinsAlaAla' ser282 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain P14921-1:p.Ser282_Tyr283delinsAspPhe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain SY DF Thu Jul 07 12:18:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser282asp,tyr283phe Fri Jul 22 11:10:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser282asp,tyr283phe' Wed May 02 18:45:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_tyr282-283asp_phe' Tue Jun 30 18:49:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser282_Tyr283delinsAspPhe' tyr283 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain P14921-1:p.Tyr283Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:26:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr283phe' Tue Jun 30 19:12:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr283Phe' P14921-1:p.[Ser276Asp;Ser282_Tyr283delinsAspPhe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain SY DF Thu Jul 07 12:18:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was ser276asp,ser282asp,tyr283phe Fri Jul 22 11:02:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276asp,ser282asp,tyr283phe' Wed May 02 17:24:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276asp,ser_tyr282-283asp_phe' Tue Jun 30 19:19:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser276Asp;Ser282_Tyr283delinsAspPhe]' ser282,ser285 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain P14921-1:p.[Ser276Ala;Tyr283Phe] mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 20:19:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser276ala,tyr283phe' Tue Jun 30 19:26:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser276Ala;Tyr283Phe]' 23 unspecified role unspecified role prey prey physical association physical association 3B Replacement of tyrosine 283 with phenylalanine (Y283F) increased binding;converting serines 276+282 to alanine abrogated COP1 binding by the Y283F variant; however replacing either Ser276 or Ser282 with aspartic acid enhanced binding. Phosphorylation of ETS1 Ser276 and Ser282 promotes binding to COP1, while Tyr283 phosphorylation decreases binding. The S276A/S282A/Y283F mutant NOT added as looks to have same binding as WT- and is covered in comment. All other mutants except V203A/P281A look "increasing" compared to WT to my eye. Cells were treated with 10 μM MG132 ets1-rfwd2-5 1 23 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait physical association physical association 4D Dasatinib -an Src family TKI MG132 loss of ETS1 tyrosine phosphorylation after treatment with dasatinib led to a reciprocal increase in COP1 binding I have not added an increasing ptm toETS1 as the phosph-antibody is not ETS1 specific. ets1-rfwd2-6 3 18 unspecified role unspecified role bait bait P14921-1:p.Val280_Pro281delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VP AA Thu Jul 07 12:17:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was val280ala,pro281ala Fri Jul 22 11:12:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val280ala,pro281ala' Wed May 02 19:55:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_pro280-281ala_ala' Tue Jun 30 17:14:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val280_Pro281delinsAlaAla' P14921-1:p.Tyr283Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 19:02:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr283phe' Tue Jun 30 19:46:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr283Phe' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role prey prey physical association physical association 4E Dasatinib -an Src family TKI ets1-src 5 18 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Supp 3B I am acting as assumption that as the isoform 1 of ETS1 has been used elsewhere (see Fig 2) they have used it here. P14921-1 phosphores P12931 decreases binding of P14921 to Q8NHY2 P12931 decreases degradation at protein level of P14921 src-1 5 15 putative self putative self putative self putative self n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation true Supp 3B ets1-src-1 4 18 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 enzyme enzyme neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Supp 3C I am acting as assumption that as the isoform 1 of ETS1 has been used elsewhere (see Fig 2) they have used it here. P14921-1 tyr-283 O-phospho-L-tyrosine