IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... Lysates from Mtdh−/− Mouse mammary epithelial cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions mouse-breast_luminal_adenocarcinoma MOUSE breast luminal adenocarcinoma breast_luminal_adenocarcinoma breast luminal adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... Lysates from Mtdh+/+ (and Mtdh-/-) Mouse mammary tumor cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions mouse-breast_luminal_adenocarcinoma MOUSE breast luminal adenocarcinoma breast_luminal_adenocarcinoma breast luminal adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... Lysates from Mtdh+/+ Mouse mammary tumor cells, carrying a transgene containing the Mouse mammary tumor virus (MMTV) long terminal repeat (promoter/enhancer) and the Polyoma Virus middle T antigen (the oncogene). The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. MTDH-SND1 Interaction Is Crucial for Expansion and Activity of Tumor-Initiating Cells in Diverse Oncogene- and Carcinogen-Induced Mammary Tumors. Cancer Cell (1535-6108) 2014 imex curation Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Only protein-protein interactions mouse-4t1 4T1 Mouse metastatic mammary carcinoma cell line 4t1 4T1 Mouse metastatic mammary carcinoma cell line http://www.lgcstandards-atcc.org/products/all/CRL-2539.aspx?geo_country=gb anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wan L., Lu X., Yuan S., Wei Y., Guo F., Shen M., Yuan M., Chakrabarti R., Hua Y., Smith H.A., Blanco M.A., Chekmareva M., Wu H., Bronson R.T., Haffty B.G., Xing Y., Kang Y. Cancer - Interactions investigated in the context of cancer no Interpro entry for Lyric, for some reason (entry created 2003) - so cannot add any XRefs for domains etc... The authors have stated that His-SND1-DeltaC, (aas 1-339) is of human origin and that GST-tagged MTDH fragments AND also for His-SND1-DeltaC, (aas 1-339) were expressed in bacteria.(Figure 5). ykang@princeton.edu Accepted 2015-MAY-26 by PPORRAS Cancer Cell (1535-6108) 2014 Only protein-protein interactions imex curation Done - I have added a new interaction. I have left Fig 5D/E interaction alone ( (EBI-9682665)); I have changed this - (but it may revert back...) lyric_human Protein LYRIC Lysine-rich CEACAM1 co-isolated protein 3D3/LYRIC Metastasis adhesion protein Astrocyte elevated gene-1 protein MTDH AEG1 LYRIC Metadherin protein protein human Homo sapiens Human MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRKKLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAGEEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKTRPKQEKAFSLKTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPILQETDKSKSNTKQNSVPPSQTKSETSWESPKQIKKKKKARRET 2460D6218FD3A4C4 snd1_mouse Staphylococcal nuclease domain-containing protein 1 p100 co-activator 100 kDa coactivator Snd1 protein protein mouse Mus musculus Mouse MASSAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMDGANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAHYEERPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISSHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR DIP protein Q78PY7 original sequence version: 75 7A31459E9274D0B6 ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q9UKV8 original sequence version: 1(def) DIP protein Q9UKV8 original sequence version: 44 DIP protein Q9UKV8 original sequence version: 60 DIP protein Q9UKV8 original sequence version: 62 DIP protein Q9UKV8 original sequence version: 89 DIP protein Q9UKV8 original sequence version: 85 DIP protein Q9UKV8 original sequence version: 87 DIP protein Q9UKV8 original sequence version: 99 DIP protein Q9UKV8 original sequence version: 117 DIP protein Q9UKV8-1 original sequence version: 117 DIP protein Q9UKV8 original sequence version: 145 DIP protein Q9UKV8 original sequence version: 108 5C8552C43FC81345 snd1_human Staphylococcal nuclease domain-containing protein 1 100 kDa coactivator EBNA2 coactivator p100 Tudor domain-containing protein 11 SND1 p100 co-activator TDRD11 protein protein human Homo sapiens Human MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR DIP protein Q7KZF4 original sequence version: 43 DIP protein Q7KZF4 original sequence version: 88 D58BF200F3F3D628 lyric_mouse Protein LYRIC Lysine-rich CEACAM1 co-isolated protein 3D3/LYRIC Metastasis adhesion protein Mtdh Lyric Metadherin protein protein mouse Mus musculus Mouse MAARSWQDELAQQAEEGSARLRELLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALGLLLLFLLGYGWAAACAGARKKRRSPPRKREEAAPPTPAPDDLAQLKNLRSEEQKKKNRKKLPEKPKPNGRTVEVPEDEVVRNPRSITAKQAPETDKKNEKSKKNKKKSKSDAKAVQNSSRHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENIITVTTEQLTTASFPVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSRLNENLTVNGGGWSEKSVKLSSQLSEEKWNSVPPASAGKRKTEPSAWTQDTGDTNANGKDWGRNWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPSSDWNAPAEEWGNWVDEDRASLLKSQEPISNDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSHTQDTEDLEKDTREELPVNTSKARPKQEKACSLKTMSTSDPAEVLIKNSQPVKTLPPAISAEPSITLSKGDSDNSSSQVPPMLQDTDKPKSNAKQNSVPPSQTKSETNWESPKQIKKKKKARRET E47E98303F588126 mtdh-ago2-2 2 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5Di mtdh-ago2-1 2 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation mutation certain certain sequence position certain certain certain sequence position certain DW RD certain certain sequence position certain certain certain sequence position certain D R Fri Jul 22 10:53:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp393arg,trp394asp' Wed May 02 15:20:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp_trp393-394arg_asp' Tue Jun 30 20:24:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp389Arg;Asp393_Trp394delinsArgAsp]' physical association physical association 5Dii SND1-binding deficient TPM1 and TPM2 MTDH were still able to interact with AGO2. mtdh-mtdh-1 2 8 unspecified role unspecified role bait bait Q86UE4:p.Trp394Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W D Wed May 02 14:48:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp394asp' Tue Jun 30 17:04:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp394Asp' Q86UE4:p.Trp401Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W D Wed May 02 16:16:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp401asp' Tue Jun 30 20:00:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp401Asp' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain DW RD Thu Jul 07 12:07:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp389arg,asp393arg,trp394asp Fri Jul 22 11:08:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp393arg,trp394asp' Wed May 02 18:38:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp_trp393-394arg_asp' Tue Jun 30 18:51:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp389Arg;Asp393_Trp394delinsArgAsp]' Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EEW RRD Thu Jul 07 12:07:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu399arg,glu400arg,trp401asp Fri Jul 22 10:50:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu399arg,glu400arg,trp401asp' Wed May 02 19:36:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu_trp399-401arg_arg_asp' Tue Jun 30 18:04:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu399_Trp401delinsArgArgAsp' 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5 D/E mtdh-snd1 3 12 unspecified role unspecified role bait bait Q80WJ7:p.Trp391Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W D Wed May 02 14:57:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp391asp' Tue Jun 30 20:13:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp391Asp' Q80WJ7:p.[Asp386Arg;Asp390_Trp391delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain DW RD certain certain sequence position certain certain certain sequence position certain D R Thu Jul 07 12:15:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp386arg,asp390arg,trp391asp Fri Jul 22 11:01:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp386arg,asp390arg,trp391asp' Wed May 02 15:11:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp386arg,asp_trp390-391arg_asp' Tue Jun 30 17:56:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp386Arg;Asp390_Trp391delinsArgAsp]' Q80WJ7:p.Glu396_Trp398delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EEW RRD Thu Jul 07 12:16:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu396arg,glu397arg,trp398asp Fri Jul 22 10:58:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu396arg,glu397arg,trp398asp' Wed May 02 19:23:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu_trp396-398arg_arg_asp' Tue Jun 30 16:25:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu396_Trp398delinsArgArgAsp' Q80WJ7:p.Trp398Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain W D Wed May 02 20:01:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp398asp' Tue Jun 30 18:10:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp398Asp' 9 unspecified role unspecified role prey prey physical association physical association 6 A/E mtdh-snd1-4 1 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Supp 4A mtdh-snd1-1 7 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Supp 4B snd1-mtdh-1 5 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association Supp 4C mtdh-snd1-2 4 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Supp 4D When tumours from Lyric knockout mice were IP-ed, Snd1 was not precipitated. mtdh-snd1-3 6 8 unspecified role unspecified role bait bait Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EEW RRD Thu Jul 07 12:17:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu399arg,glu400arg,trp401asp Fri Jul 22 10:57:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu399arg,glu400arg,trp401asp' Wed May 02 17:10:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu_trp399-401arg_arg_asp' Tue Jun 30 17:48:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu399_Trp401delinsArgArgAsp' Q86UE4:p.[Asp389Arg;Asp393_Trp394delinsArgAsp] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain DW RD certain certain sequence position certain certain certain sequence position certain D R Thu Jul 07 12:17:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp389arg,asp393arg,trp394asp Fri Jul 22 11:12:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp393arg,trp394asp' Wed May 02 14:33:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp389arg,asp_trp393-394arg_asp' Tue Jun 30 16:13:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp389Arg;Asp393_Trp394delinsArgAsp]' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined subregion from lung-homing for mammary tumors region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 5B/C this might be a "direct" interaction - but in the absence of any info as to purification (or any method etc...) have left as "physical". Author states was "E.coli expressed". mtdh-ago2-3 2 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q86UE4:p.Glu399_Trp401delinsArgArgAsp mutation mutation certain certain sequence position certain certain certain sequence position certain EEW RRD Fri Jul 22 11:12:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu399arg,glu400arg' Wed May 02 17:40:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu_trp399-401arg_arg_asp' Tue Jun 30 16:42:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu399_Trp401delinsArgArgAsp' physical association physical association 5Dtpm2 SND1-binding deficient TPM1 and TPM2 MTDH were still able to interact with AGO2.