IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-utmc2 Human Utmc2 monoclonal plasma cell line utmc2 UTMC2 monoclonal plasma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line pull down pull down western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. The "protease-dead version of the caspase-10 D isoform in which the catalytic site cysteine was replaced by serine. " has been entered as cys401ser. However no reply was received from the authors to confirm this is the correct mutation. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent ( see Supplemental Experimental Procedures -Molecular biology). The Tap tag consists of a C terminal streptavidin binding protein and calmodulin binding protein, according to the Agilent/Stratagene web site. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent. The Tap tag consists of a C terminal streptavidin binding protein and calmodulin binding protein, according to the Agilent/Stratagene web site. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation Control of autophagic cell death by caspase-10 in multiple myeloma. Control of autophagic cell death by caspase-10 in multiple myeloma. Cancer Cell (1535-6108) 2013 imex curation Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-kms12 KMS12 Myeloma cell line kms12 KMS12 Myeloma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lamy L., Ngo V.N., Emre N.C., Shaffer A.L., Yang Y., Tian E., Nair V., Kruhlak M.J., Zingone A., Landgren O., Staudt L.M. Cancer - Interactions investigated in the context of cancer Several experiments in this publication use the cell line "KMS12". The authors have not replied to requests for clarification as to whether this cell line is KMS12-PE or KMS12-BM. lstaudt@mail.nih.gov Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation o15519-pro_0000004678 CASP8 and FADD-like apoptosis regulator subunit p43 CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVD 1 376 D6127C24F8840C2D caspa_human_gene Human CASPASE 10 gene gene gene human Homo sapiens Human caspa_human Caspase-10 ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 CASP10 MCH4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS 840348AE602B8243 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB q92851-4 Caspase-10 10-D 10-L CASP10 MCH4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 ICE-like apoptotic protease 4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL Variant in position: 522:L->I (not associated with significantly altered cutaneous melanoma risk, dbSNP:rs13006529). 34847E07B3DFA688 irf4_human Interferon regulatory factor 4 Lymphocyte-specific interferon regulatory factor NF-EM5 Multiple myeloma oncogene 1 IRF4 MUM1 protein protein human Homo sapiens Human MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE 17CD1327C6F5BFFA cflar_human CASP8 and FADD-like apoptosis regulator Cellular FLICE-like inhibitory protein Caspase-eight-related protein Caspase-like apoptosis regulatory protein MACH-related inducer of toxicity Caspase homolog Inhibitor of FLICE FADD-like antiapoptotic molecule 1 Usurpin CFLAR CASH CLARP MRIT CASP8AP1 protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT 8C6D7E92AE1EB672 cflar_human_gene CASP8 and FADD-like apoptosis regulator gene gene gene human Homo sapiens Human bclf1_human Bcl-2-associated transcription factor 1 BCLAF1 and THRAP3 family member 1 BCLAF1 BTF KIAA0164 protein protein human Homo sapiens Human MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYSSRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYGYRGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSSSSRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSGDIWPGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSSRYSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLKRFTDEESRVFLLDRGNTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQGKSFATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITVKKETQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSNRPASLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVKEQYFKSAAMTLNERFTSYQKATEEHSTRQKSPEIHRRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRKERSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDDSKHKREQDHSRSSSSSASPSSPSSREEKESKKEREEEFKTHHEMKEYSGFAGVSRPRGTFFRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPKSKKYFLHDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEEKKDRRKEEKE 8892B98E54F52C20 o15519-1 CASP8 and FADD-like apoptosis regulator FLIP-L CLARP1 MRIT alpha-1 CASH alpha I-FLICE 1 FLAME-1 gamma Usurpin alpha CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT DIP protein O15519-1 original sequence version: 143 8C6D7E92AE1EB672 becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C cflar-casp10 7 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 4F casp10-cflar-1 7 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 4F-2 casp10-cflar-3 3 8 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q92851-4:p.Cys401Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:24:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys401ser' Tue Jun 30 19:07:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys401Ser' c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association 4G Protease-dead TAP-Casp10* associated with full-length cFLIPL as well as with p43FLIP. casp10-cflar-4 3 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4G-a Protease-dead TAP-Casp10* associated with full-length cFLIPL as well as with p43FLIP wheras the wild type only appeared to associate with the p43 form. casp10-cflar-5 4 12 unspecified role unspecified role bait bait c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 17 unspecified role unspecified role prey prey human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line 8 unspecified role unspecified role prey prey human-skmm1 SK-MM-1 skmm1 SK-MM-1 Myeloma cell line association association 4H,I Incubation of TAP-Casp10∗ with the SKMM1 extract gave a small amount of a cleaved ∼47 kDa TAP-Casp10∗ fragment. Warming to 37°C for 10 min significantly increased this cleavage of caspase-10 and the processing of cFLIPL into p43FLIP. The TAP-Caspase 10* isoform D construct carries mutations in the shCasp10-1 target sequence. These mutations are stated to be silent ( see Supplemental Experimental Procedures -Molecular biology). casp10-cflar-6 6 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 5D bcl2-becn1-3 7 11 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 6E Q-VD-OPH -a pan-caspase inhibitor. bcl2-bclaf1 6 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 6G. Q-VD-OPH -a pan-caspase inhibitor. When BCLAF1-DHFR (a fusion of BCLAF1 to an 18 kDa dihydrofolate reductase (DHFR)-derived “destruction” domain) was transduced the amount of beclin-1 that could be coimmunoprecipitated with BCL-2 decreased. irf4-caspa 5 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Supp 4B Three peaks were seen for IRF4 binding; one near the Caspase10 gene TSS, and the other two in the body of the gene. Peaks were centered over repeats of an IRF4 DNA binding motif (GAAA or TTTC). irf4-caspa-1 2 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Supp 4C Primer pairs were derived from peak 1 (near to TSS) in the CASP10 locus from the ChIp-seq experiment. irf4-caspa-2 1 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Supp 4C Primer pairs were derived from peak 1 (near to TSS) in the CASP10 locus from the ChIp-seq experiment. irf4-caspa-3 5 15 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Supp 4D IRF4 binds to a promoter-proximal region in the CFLAR first intron. irf4-cflar 2 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Supp 4E IRF4 binds to a promoter-proximal region in the CFLAR first intron. irf4-cflar-1 1 13 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Supp 4E-2 IRF4 binds to a promoter-proximal region in the CFLAR first intron. casp10-cflar-7 3 12 unspecified role unspecified role bait bait Q92851-4:p.Cys401Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:42:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys401ser' Tue Jun 30 18:05:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys401Ser' c_terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role prey prey physical association physical association Supp 5E Full-length BCLAF1 readily coimmunoprecipitated with the proteolytically dead mutant TAP-Casp10∗ isoform D. bcl2-bclaf1-1 6 11 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 6F Q-VD-OPH -a pan-caspase inhibitor. Caspase inhibition strongly increased this interaction.