IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Cell Death Discovery 2016 imex curation Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org Accepted 2016-FEB-10 AT 09:59 GMT AT 09:59 GMT by MGT 2016 Only protein-protein interactions imex curation Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Cell Death Discovery 2016 imex curation Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org Accepted 2016-FEB-10 AT 09:59 GMT AT 09:59 GMT by MGT 2016 Only protein-protein interactions imex curation Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Cell Death Discovery 2016 imex curation Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org Accepted 2016-FEB-10 AT 09:59 GMT AT 09:59 GMT by MGT 2016 Only protein-protein interactions imex curation Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Cell Death Discovery 2016 imex curation Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 A bleb is a bulge, or protrusion of the plasma membrane ;apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields', which act to resist apoptosis and aid survival of these cells. Blebbishield Ejection (BE) medium, which contains LiCl and Cisplatin, induces the formation of 'blebbishields'. Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org Accepted 2016-FEB-10 AT 09:59 GMT AT 09:59 GMT by MGT 2016 Only protein-protein interactions imex curation Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Endocytosis and serpentine filopodia drive blebbishield-mediated resurrection of apoptotic cancer stem cells Cell Death Discovery 2016 imex curation Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Jinesh GG, Kamat AM, Jinesh GG, Kamat AM Cancer - Interactions investigated in the context of cancer 23-07-2015: Submitted by GG Jinesh, MD Anderson Cancer Center, Texas, USA. http://www.nature.com/articles/cddiscovery201569 Files for this submission can be found in sp/pro6/intact/local/data/curation-material/2015/jinesh_2015 Blebbishield formation is induced by "Blebbishield Ejection (BE) medium", which contains LiCl and Cisplatin; the latter crosslinking DNA leading to apoptosis. A bleb is a bulge, or protrusion of the plasma membrane; apoptotic blebs of cancer cells fuse together to form novel structures called 'blebbishields' which act to resist apoptosis and aid survival of these cells. Sequence range for beta-catenin cleaved fragment was taken from PMID:10748026. RPS6KB1 (p70S6K) isoforms were not entered as different participants since they could not be mapped to isoforms defined in UniProtKB. Every other isoform or cleavage fragment reported in this entry has been identified as per author statements. GJGerald@mdanderson.org,akamat@mdanderson.org GJGerald@mdanderson.org Accepted 2016-FEB-10 AT 09:59 GMT AT 09:59 GMT by MGT 2016 Only protein-protein interactions imex curation gnds_human Ral guanine nucleotide dissociation stimulator RALGDS RGF KIAA1308 Ral guanine nucleotide exchange factor protein protein human Homo sapiens Human MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRPESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGTLEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPAPGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPSLQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF DIP protein Q12967 original sequence version: 101 DIP protein Q12967 original sequence version: 136 EA5A5CF25AF3D523 ks6b1_human Ribosomal protein S6 kinase beta-1 RPS6KB1 STK14A Ribosomal protein S6 kinase I p70 ribosomal S6 kinase alpha 70 kDa ribosomal protein S6 kinase 1 Serine/threonine-protein kinase 14A protein protein human Homo sapiens Human MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL DIP protein P23443 original sequence version: 163 DIP protein P23443 original sequence version: 88 2C3BA13CCDAF4AB3 q05513-1 Protein kinase C zeta type nPKC-zeta PRKCZ PKC2 protein protein human Homo sapiens Human MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV 88CCD0577E6A596C vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV DIP protein P35968 original sequence version: 81 DIP protein P35968 original sequence version: 146 DIP protein P35968 original sequence version: 117 DIP protein P35968 original sequence version: 121 59E7C44B05CFEBB3 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 q05513-2 Protein kinase C zeta type nPKC-zeta PRKCZ PKC2 PKMzeta protein protein human Homo sapiens Human MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV Produced by alternative promoter usage. 21C316A4A2B418BD pak1-prkcz-1 1 10 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso-1 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PAK1-CRIB 12 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] p70S6K 7 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6C, lane ii cdc42-ctnnb1-1 1 PKC-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line beta-catenin 11 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line VEGFR2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cdc42 10 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line RalGDS 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] 13 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cleaved 72 kDa beta-catenin fragment 11 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6A, lane ii Both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. pak1-prkcz-2 4 10 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso 2 14 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso-1 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PAK1-CRIB 12 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] p70S6K 7 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6C, lane iii pak1-prkcz-3 3 10 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKM-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate pkm-zeta cleaved form sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso-1 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PAK1-CRIB 12 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] p45S6K 7 unspecified role unspecified role prey prey cell lysate cell lysate p45s6k cleaved form sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6C, lane iv ralgds-cdc42-2 3 PKC-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line 72 kDa cleaved beta-catenin fragment 11 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line VEGFR2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cdc42 10 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line RalGDS 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] association association 6A, lane iv Only caspase 3-cleaved beta-catenin was pulled-down by RalGDS, no full-length protein was present. In blebbishields, RalGDS-RBD selectively lost interactions with E-cadherin and full-length beta-catenin. pak1-prkcz-4 2 10 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso 2 14 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso-1 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PAK1-CRIB 12 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] p70S6K 7 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6C, lane v pak1-prkcz-5 5 10 unspecified role unspecified role prey prey human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PKC-zeta iso-1 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line PAK1-CRIB 12 unspecified role unspecified role bait bait purified purified crib domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range escherichia coli dh5[alpha] escherichia coli dh5[alpha] physical association physical association 6C, lane vi ralgds-cdc42-5 4 PKC-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line beta-catenin 11 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line VEGFR2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cdc42 10 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line RalGDS 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] 13 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cleaved 72 kDa beta-catenin fragment 11 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6A, lane iii Both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. ralgds-cdc42-1 2 PKC-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line beta-catenin 11 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line VEGFR2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cdc42 10 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line RalGDS 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] 13 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cleaved 72 kDa beta-catenin fragment 11 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6A, lane v Authors state that both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS. ralgds-cdc42-3 5 PKC-zeta 8 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line beta-catenin 11 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line VEGFR2 9 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cdc42 10 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line RalGDS 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range rbd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain escherichia coli dh5[alpha] escherichia coli dh5[alpha] 13 unspecified role unspecified role prey prey cell lysate cell lysate human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line cleaved 72 kDa beta-catenin fragment 11 unspecified role unspecified role prey prey cell lysate cell lysate 72 kda cleaved fragment sufficient to bind sufficient binding region sufficient to bind range range range range human-rt4 Human RT4 urinary bladder transitional cell carcinoma line Human rt4 Human urinary bladder transitional cell carcinoma RT4 line association association 6A, lane vi Authors state that both full-length and caspase 3-cleaved beta-catenin were pulled-down by RalGDS.