IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma pull down pull down sequence tag sequence tag identification sequence tag Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay western blot western blot Immuno blot Immuno blot Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) A regulatory subunit -calcineurin B is also present in the "PP2B" enzyme (assumed to be Calbiochem/Millipore cat. no 539568-5000U). The A (catalytic) and B subunits are co-expressed with yeast myristoyl-CoA:protein N-myristoyltransferase. The exact identity of the regulatory B subunit is not given. The active enzyme is stated to be N-myristoylated on the calcineurin B-subunit, -as is the native protein. butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions. Oncogene (0950-9232) 2012 imex curation Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mihlan S., Reiß C., Thalheimer P., Herterich S., Gaetzner S., Kremerskothen J., Pavenstädt H.J., Lewandrowski U., Sickmann A., Butt E. Cancer - Interactions investigated in the context of cancer According to M+M there is a Platelet Pull Down assay, and according to text- "performed pull-down assays with platelet homogenate and MDA-MB231 cell lysate" - I think refering to Fig 4A - but I can find NO results for platelets, only MDA-MB231. (can you find any? - I cant see it in the paper nor in Supplement...) butt@klin-biochem.uni-wuerzburg.de Accepted 2013-MAY-20 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation zo2_human Tight junction protein ZO-2 TJP2 X104 Zonula occludens protein 2 Zona occludens protein 2 Tight junction protein 2 ZO2 protein protein human Homo sapiens Human MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLFDQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL 27305B723043BF6C pp2ba_human Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform PPP3CA CALNA CNA Calmodulin-dependent calcineurin A subunit alpha isoform CAM-PRP catalytic subunit protein protein human Homo sapiens Human MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ 16480D62DDBF1F40 zyx_human Zyxin Zyxin-2 ZYX protein protein human Homo sapiens Human MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLPQVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT 2833B1EFA260B762 lasp1_human LIM and SH3 domain protein 1 Metastatic lymph node gene 50 protein LASP1 MLN50 protein protein human Homo sapiens Human MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 3B89B988605B3639 dyn1_human Dynamin-1 DNM1 DNM protein protein human Homo sapiens Human MGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILVIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPAGSALGGAPPVPSRPGASPDPFGPPPQVPSRPNRAPPGVPSRSGQASPSRPESPRPPFDL DIP protein Q05193 original sequence version: 142 DIP protein Q05193 original sequence version: 113 DIP protein Q05193 original sequence version: 100 DIP protein Q05193 original sequence version: 115 DIP protein Q05193-1 original sequence version: 111 DIP protein Q05193 original sequence version: 153 7FCD8CB572FFEAEF q9udy2-3 Tight junction protein ZO-2 TJP2 X104 ZO2 Tight junction protein 2 Zona occludens protein 2 Zonula occludens protein 2 protein protein human Homo sapiens Human MEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLFDQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL Produced by alternative promoter usage. 91F7D588687D179E lpp_human Lipoma-preferred partner LIM domain-containing preferred translocation partner in lipoma LPP protein protein human Homo sapiens Human MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTLKPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPVSAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCGENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCSKPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL 439CE0101FDE4DDD dyn2_human Dynamin-2 DNM2 DYN2 protein protein human Homo sapiens Human MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQQRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD DIP protein P50570 original sequence version: 149 DIP protein P50570 original sequence version: 100 DIP protein P50570 original sequence version: 160 2F4567B75980935D lasp1-ppp3ca 5 10 enzyme enzyme neutral component neutral component ser146 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation 3A/B cypermethrin (an insecticide) a PP2B inhibitor. lasp1-dnm1 2 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Supp Fig 2 lasp1-dnm1-2 6 9 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role bait bait sh3_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 13 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma association association 4A, 4D LASP1 phosphorylated at Ser-146 showed decreased binding to zyxin and LPP, whereas the binding to ZO-2 was unaffected. Binding of the phospho-mimetic mutant LASP-S146D was similarly affected. I cannot think of how to add the ser-146 as a "decreasing" feature - it is not a mutation decreasing... tjp2-lasp1 3 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 4B lasp1-lpp-4 1 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A-1, 6B. LPP is preferentially bound to unphosphorylated LASP-1. lasp1-zyx 1 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A-2 lasp1-tjp2 1 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A-3, 6A/B The ZO-2/LASP-1 interaction appeared to be much stronger using an antibody to phosphorylated LASP1 rather than to the un-phosphorylated target. lasp1-lpp-1 6 12 unspecified role unspecified role prey prey Q9UDY2-3:p.[Pro1106Ala;Pro1116Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:28:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1106ala,pro1116ala' Tue Jun 30 15:44:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro1106Ala;Pro1116Ala]' Q9UDY2-3:p.Pro1106Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:32:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro1106ala' Tue Jun 30 19:46:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro1106Ala' human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 4C tjp2-lasp1-2 4 7 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Supp 3 lasp1-lpp-2 6 9 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14847:p.Ser146Asp mutation mutation certain certain sequence position certain certain certain sequence position certain S D Wed May 02 18:22:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser146asp' Tue Jun 30 15:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser146Asp' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma association association 4D -2 LASP1 phosphorylated at Ser-146 showed decreased binding to zyxin, whereas the binding to ZO-2 was unaffected. Binding of the phospho-mimetic mutant LASP-S146D was similarly affected. lasp1-lpp-3 6 9 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 13 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range phospho_ser146 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma association association 4D -3 LASP1 phosphorylated at Ser-146 showed decreased binding to zyxin and LPP, whereas the binding to ZO-2 was unaffected. Binding of the phospho-mimetic mutant LASP-S146D was similarly affected. tjp2-lasp1-3 4 13 competitor competitor competitor unspecified role unspecified role human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 10 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma association association Supp 3-2 tjp2-lasp1-4 4 10 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma 9 competitor competitor competitor unspecified role unspecified role human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma association association Supp 3-3