IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. Cancer Cell (1535-6108) 2011 imex curation Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu 14-Mar-2012: Contacted by JYOTI. orchard orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu Accepted 2011-DEC-14 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. Cancer Cell (1535-6108) 2011 imex curation Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu 14-Mar-2012: Contacted by JYOTI. orchard orchard Only protein-protein interactions human-mm6 Human-Mono Mac 6 monoblastic leukemic cell line mm6 Mono Mac 6 human monoblastic leukemic cell line cell line derived from PBLs of a patient with monoblastic leukemia. Contains an endogenous MLL-AF9 translocation. Contains an endogenous MLL-AF9 translocation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. MM6 cells (containing an endogenous MLL-AF9 translocation) and stably transduced with aTRIPZ-RFP-shCBX8- lentiviral construct, expression of which is induced by doxycycline, resulting in CBX8 knockdown. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu Accepted 2011-DEC-14 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. Cancer Cell (1535-6108) 2011 imex curation Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu 14-Mar-2012: Contacted by JYOTI. orchard orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu Accepted 2011-DEC-14 by ORCHARD Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. Cancer Cell (1535-6108) 2011 imex curation Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu 14-Mar-2012: Contacted by JYOTI. orchard orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu Accepted 2011-DEC-14 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. CBX8, a Polycomb Group Protein, Is Essential for MLL-AF9-Induced Leukemogenesis. Cancer Cell (1535-6108) 2011 imex curation Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu 14-Mar-2012: Contacted by JYOTI. orchard orchard Only protein-protein interactions mouse Mus musculus Mouse ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tan J., Jones M., Koseki H., Nakayama M., Muntean A.G., Maillard I., Hess J.L. Cancer - Interactions investigated in the context of cancer To Checker: please check that all expected annotations have been added to the Experiments - as I had to do this manually as the automatic process did not work- details that were added at the publication level were NOT automatically transferred to Experiment level, -neither were short labels for the expts. The authors have confirmed that the (leukaemic/transformed) hematopoietic cells used were derived from primary murine bone marrow (BM). Ethanol treated cells were all myeloblasts, but the 4-OHT treated cells were a mixed population of myeloblasts and more differentiated cells (the exact types were not further defined). Cells used were:MLL-AF9-transformed murine hematopoietic cells from Cbx8f/f; Cre+ Cbx8 conditional knockout mice. Treatment with 4-hydroxyltamoxifen (4-OHT) induced efficient Cbx8 excision. The Mll-AF9 fusion protein has previously been confirmed to be Human in origin (see Muntean 2010, Cancer Cell, PMID:20541477, and also Muntean 2008, Blood, PMID:18796627). The authors have confirmed that the Flag-CBX8 and HA-DOT1L constructs are of Human origin. They have additionally confirmed that the MLL-AF9 fusion protein is made up from MLL aa 1-1396 (from Muntean 2008) and AF9 aa 482-568 ( in this publication); also that the CxxC-AF9 construct contains aas 1115-1201- from MLL. jayhess@umich.edu Accepted 2011-DEC-14 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Cancer Cell (1535-6108) 2011 orchard Only protein-protein interactions imex curation hoxa9_mouse_gene Mouse HOXA9 gene gene gene mouse Mus musculus Mouse af9_mouse Protein AF-9 Mllt3 Af9 Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein homolog protein protein mouse Mus musculus Mouse MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSMLPPFDDIVDPNDSDVEENMSSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEAEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS DIP protein A2AM29 original sequence version: 46 120A0604B13675EC hoxa9_human_gene Human HOXA9 gene gene gene human Homo sapiens Human rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P24928 original sequence version: 108 DIP protein P24928 original sequence version: 147 DIP protein P24928 original sequence version: 158 DIP protein P24928 original sequence version: 157 DIP protein P24928 original sequence version: 179 DIP protein P24928 original sequence version: 181 DIP protein P24928 original sequence version: 161 DIP protein P24928 original sequence version: 175 DIP protein P24928-1 original sequence version: 175 DIP protein P24928 original sequence version: 68 DIP protein P24928 original sequence version: 116 28D6FD25693A6472 aff4_human AF4/FMR2 family member 4 AFF4 AF5Q31 MCEF ALL1-fused gene from chromosome 5q31 protein Major CDK9 elongation factor-associated protein HSPC092 protein protein human Homo sapiens Human MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKWTPVGPAPSTSQSQKRSSGLQSGHSSQRTSAGSSSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSLNSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSTQSFPPSLMSKSNSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKIPSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGTGEQKRYNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSSLKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSKPRRTKLVFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAKLIS 474E1906B8832AC1 cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein P50750 original sequence version: 100 DIP protein P50750 original sequence version: 115 DIP protein P50750-1 original sequence version: 119 DIP protein P50750 original sequence version: 170 DIP protein P50750 original sequence version: 184 DIP protein P50750-1 original sequence version: 144 DIP protein P50750 original sequence version: 70 DIP protein P50750 original sequence version: 120 69E851CC6F7A0388 cbx8_mouse Chromobox protein homolog 8 Cbx8 Pc3 Polycomb 3 homolog protein protein mouse Mus musculus Mouse MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSTRGIRIPYPGRSPQDLASTSRAREGLRNTGLPPPGSSTSTCRADPPRDRDRERDRGTSRVDDKPSSPGDSSKKRGPKPRKEPLDPSQRPLGEPSAGLGEYLKGRKLDETSSGTGKFPAGHSVIQLARRQDSDLVQYGVTSPSSAEASSKLAVDTFPARVIKHRAAFLEAKGQGALDPGGARVRHSSGTPASVGSLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR EE047F57483741B2 rpb1_mouse DNA-directed RNA polymerase II subunit RPB1 Polr2a Rpii215 Rpo2-1 DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit protein protein mouse Mus musculus Mouse MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P08775 original sequence version: 94 DIP protein P08775 original sequence version: 114 DIP protein P08775 original sequence version: 110 DIP protein P08775 original sequence version: 123 7D76F38FD92A657E kat5_human Histone acetyltransferase KAT5 KAT5 TIP60 HTATIP Lysine acetyltransferase 5 cPLA(2)-interacting protein Histone acetyltransferase HTATIP 60 kDa Tat-interactive protein protein protein human Homo sapiens Human MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW DIP protein Q92993 original sequence version: 153 DIP protein Q92993 original sequence version: 155 DIP protein Q92993 original sequence version: 86 DIP protein Q92993 original sequence version: 149 DIP protein Q92993-1 original sequence version: 129 DIP protein Q92993 original sequence version: 144 DIP protein Q92993 original sequence version: 173 63724F5E10B957D5 ring2_human E3 ubiquitin-protein ligase RING2 RING finger protein 2 RING finger protein 1B RING finger protein BAP-1 Protein DinG Huntingtin-interacting protein 2-interacting protein 3 RNF2 BAP1 DING HIPI3 RING1B RING-type E3 ubiquitin transferase RING2 protein protein human Homo sapiens Human MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q99496 original sequence version: 95 DIP protein Q99496 original sequence version: 94 DIP protein Q99496 original sequence version: 96 DIP protein Q99496 original sequence version: 125 DIP protein Q99496 original sequence version: 142 DIP protein Q99496 original sequence version: 159 DIP protein Q99496 original sequence version: 129 DIP protein Q99496 original sequence version: 99 DIP protein Q99496 original sequence version: 118 90EA546E1F4DB7EC af9_human Protein AF-9 ALL1-fused gene from chromosome 9 protein Myeloid/lymphoid or mixed-lineage leukemia translocated to chromosome 3 protein YEATS domain-containing protein 3 MLLT3 AF9 YEATS3 protein protein human Homo sapiens Human MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKAPSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKSTLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESDEVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS DIP protein P42568 original sequence version: 135 DIP protein P42568 original sequence version: 103 DIP protein P42568 original sequence version: 136 0A020B7FB34132F9 cbx8_human Chromobox protein homolog 8 Polycomb 3 homolog Rectachrome 1 CBX8 PC3 RC1 protein protein human Homo sapiens Human MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSSTCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDPSQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR DIP protein Q9HC52 original sequence version: 81 DIP protein Q9HC52 original sequence version: 80 DIP protein Q9HC52 original sequence version: 102 DIP protein Q9HC52 original sequence version: 107 651263C85B0ECD93 ccnt1_human Cyclin-T1 CCNT1 protein protein human Homo sapiens Human MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPPLPPLPK DIP protein O60563 original sequence version: 85 DIP protein O60563 original sequence version: 79 DIP protein O60563 original sequence version: 98 DIP protein O60563 original sequence version: 102 DIP protein O60563 original sequence version: 164 DIP protein O60563 original sequence version: 125 DIP protein O60563 original sequence version: 103 4637EFB2DDEDFE13 dot1l_human Histone-lysine N-methyltransferase, H3 lysine-79 specific DOT1L KIAA1814 KMT4 Histone H3-K79 methyltransferase DOT1-like protein Lysine N-methyltransferase 4 protein protein human Homo sapiens Human MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTANPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPTPPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGYELCGVLSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIVLRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQLAGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARSTPSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGAEPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPLPEASKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTASARGDCVPSHGQDSRRRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEITAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARIERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSPLQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGGGLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLKGEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLSGPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSSVPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGN DIP protein Q8TEK3 original sequence version: 90 DIP protein Q8TEK3 original sequence version: 110 9CEA12850DC4ACB1 mll_af9_human_protein MLL-AF9 fusion protein protein protein human Homo sapiens Human MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADKSPIKQSKSDKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQSYLETSGTS An amino acid sequence which is not represented in UniProt MLL derived protein of the protein corresponds to the CxxC-RD2 portion of the parent protein, only. mll_af9_human_-mllt3 3 20 unspecified role unspecified role bait bait n_terminus_mll flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1B mll_af9_human_p-cbx8 1 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait thr1457ala,thr1469ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A n_terminus_mll flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 1C, 1D. cbx8-mll_af9_human_p 4 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey thr1457ala,thr1469ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1E mll_af9_human-cbx8-1 4 20 unspecified role unspecified role bait bait thr1457ala,thr1469ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S1B mll_af9_human_p-aff4 1 10 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1F dot1l-mll_af9_human_ 4 20 unspecified role unspecified role prey prey n_terminus_mll flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S1D cbx8-hoxa9 5 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4J Cbx8 binding to the Hoxa9 promoter is ablated by 4-OHT treatment. polr2a-hoxa9 5 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4K a significant decrease of RNA polymerase II binding to the Hoxa9 promoter was detected following Cbx8 depletion by 4-OHT treatment. mllt3-hoxa9 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4L Binding of MLL-AF9 fusion protein and WT AF9 to the Hoxa9 promoter was not affected by Cbx8 depletion. The anti-AF9 antibody used might also detect binding of the transduced MLL-AF9 fusion protein, but as the epitope recognised by the AF9 antibody is not known, (nor the exact antibody used), we cannot be certain. mll_af9_human_p-rnf2 1 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait thr1457ala,thr1469ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain T A region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 5A cbx8-kat5 1 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey physical association physical association Fig 6A kat5-hoxa9 5 14 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6I Cbx8 depletion resulted in decreased Tip60 binding at the Hoxa9 promoter. cbx8-hoxa9-1 2 17 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4J Doxycycline treatment resulted in the expected reduction of binding to the Hoxa9 promoter. polr2a-hoxa9-3 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4K Doxycycline treatment and subsequent Cbx8 knockdown resulted in the reduction of binding to the Hoxa9 promoter. mllt3-hoxa9-1 2 8 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait association association S4L Doxycycline treatment (and subsequent Cbx8 knockdown) resulted in NO reduction of binding to the Hoxa9 promoter. The anti-AF9 antibody used might also detect binding by the MLL-AF9 fusion protein expressed by this cell line, but as the sequence from AF9 incorporated into the endogenous MLL-AF9 fusion protein is not known, and neither is the epitope recognised by the antibody, (nor the exact antibody used) we cannot be certain. kat5-hoxa9-1 2 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S6I Doxycycline treatment and subsequent Cbx8 knockdown resulted in the reduction of binding to the Hoxa9 promoter. dot1l-mll_af9_huma-1 4 19 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1G The interaction between DOT1L and CxxC-AF9 was also retained in the T542A and T554A mutants. mll_af9_human_-dot1l 4 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mll_cxxc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig S1C The interaction between DOT1L and CxxC-AF9 was also retained in the T542A and T554A mutants.