I2D I2D A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. A retinoic acid receptor RARα pool present in membrane lipid rafts forms complexes with G protein αQ to activate p38MAPK. Oncogene (0950-9232) 2012 imex curation Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-bt474 Homo sapiens breast ductal carcinoma cell line bt474 Human breast ductal carcinoma cell line BT474 Human breast ductal carcinoma cell line established from a solid, invasive ductal carcinoma of the breast obtained from a 60-year-old woman. density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Piskunov A., Rochette-Egly C. Cancer - Interactions investigated in the context of cancer cegly@igbmc.fr Accepted 2012-SEP-17 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database flot2_human Flotillin-2 FLOT2 ESA1 M17S1 Epidermal surface antigen Membrane component chromosome 17 surface marker 1 protein protein human Homo sapiens Human MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV F690BFE0151D3BD7 rara_mouse Retinoic acid receptor alpha Rara Nr1b1 Nuclear receptor subfamily 1 group B member 1 protein protein mouse Mus musculus Mouse MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP DIP protein P11416 original sequence version: 140 726F7799633A85AD rock2_human Rho-associated protein kinase 2 ROCK2 KIAA0619 Rho-associated, coiled-coil-containing protein kinase II Rho-associated, coiled-coil-containing protein kinase 2 p164 ROCK-2 Rho kinase 2 protein protein human Homo sapiens Human MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS 876240F410C2487E kpcd_human Protein kinase C delta type nPKC-delta PRKCD Tyrosine-protein kinase PRKCD PKCD protein protein human Homo sapiens Human MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED DIP protein Q05655 original sequence version: 92 DIP protein Q05655 original sequence version: 171 013F4314A2EE331A rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 gnaq_mouse Guanine nucleotide-binding protein G(q) subunit alpha Guanine nucleotide-binding protein alpha-q Gnaq protein protein mouse Mus musculus Mouse MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P21279 original sequence version: 157 DIP protein P21279 original sequence version: 127 DIP protein P21279 original sequence version: 141 DIP protein P21279 original sequence version: 170 3BCBA4EE7DADADBF flot2_mouse Flotillin-2 Epidermal surface antigen Flot2 Esa1 M17s1 Membrane component chromosome 17 surface marker 1 homolog protein protein mouse Mus musculus Mouse MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV E482A0E2071D3CA7 gnaq_human Guanine nucleotide-binding protein G(q) subunit alpha GNAQ GAQ Guanine nucleotide-binding protein alpha-q protein protein human Homo sapiens Human MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P50148 original sequence version: 154 6F69C4F617DFA7C7 rara-gnaq 5 16 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated in vitro In vitro 13 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 4a flot2-gnaq 1 16 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 3b flot2-rara-1 4 15 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 3h rara-gnaq-1 3 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 4b Binding and detection of GalphaQ occurs after treatment with RA for 5-30mins. rara-gnaq-2 6 16 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 4c MCF7 cells were treated with RA for 10 mins before preparing lipid rafts via sucrose gradient centrifugation for immunoprecipitation with monoclonal RARalpha antibodies. gnaq-rara 2 16 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5, 8k-p RARalpha/GalphaQ complexes increase in cells stimulated for 10 or 30 minutes with RA. gnaq-rara-1 7 10 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6 RARalpha/GalphaQ complexes increase in cells stimulated for 10 or minutes with RA. flot2-gnaq-1 8 9 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 8c Though RARalpha/GalphaQ are weakly detectable in lipid raft fractions in BT474 cells (which are defective in p38MAPK activation), complexes between the two are not seen using in situ PLA.