I2D I2D Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Oncogene (0950-9232) 2011 Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu 19-Sept-2012: Contacted by IntAct-Help. Curated by: I2D - Interologous Interaction Database yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu Accepted 2012-JUN-14 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Curated by: I2D - Interologous Interaction Database Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Oncogene (0950-9232) 2011 Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu 19-Sept-2012: Contacted by IntAct-Help. Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu Accepted 2012-JUN-14 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Curated by: I2D - Interologous Interaction Database Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Oncogene (0950-9232) 2011 Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu 19-Sept-2012: Contacted by IntAct-Help. Curated by: I2D - Interologous Interaction Database human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu Accepted 2012-JUN-14 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Curated by: I2D - Interologous Interaction Database Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells. Oncogene (0950-9232) 2011 Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu 19-Sept-2012: Contacted by IntAct-Help. Curated by: I2D - Interologous Interaction Database human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Yu Y.P., Luo J.H. Cancer - Interactions investigated in the context of cancer ypyu@pitt.edu Accepted 2012-JUN-14 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2011 Curated by: I2D - Interologous Interaction Database ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 synp2_human Synaptopodin-2 SYNPO2 Genethonin-2 Myopodin protein protein human Homo sapiens Human MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRNQSKASGSGLCEGDEVVSINGNPCADLTYPEVIKLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVESTTLQIRPATKTQCTEFFLAPVKTEVPLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKGASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAGLPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHKHRARHARLRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELEREADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDKMEMLPDTTGKGALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHGLGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPATPFSPTRNMTSPIADFPAPPPYSAVTPPPDAFSRGVSSPIAGPAQPPPWPQPAPWSQPAFYDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSSQPVTPVSPVWSPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNYTPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARAQSPTPSLPASWKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLNALDVMKHQPYQLNASLFTFQPPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQASSVYSVPAYTSPPSFFAEASSPVSASPVPVGIPTSPKQESASSSYFVAPRPKFSAKKSGVTIQVWKPSVVEE 8DF6F4D2823B444D synpo2-ilk 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1a ilk-synpo2 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1b synpo2-ilk-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1b synpo2-ilk-2 2 5 unspecified role unspecified role prey prey human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1c synpo2-ilk-3 2 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1c ilk-synpo2-1 4 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 1d