I2D I2D Sumoylation of MEL1S at lysine 568 and its interaction with CtBP facilitates its repressor activity and the blockade of G-CSF-induced myeloid differentiation. Sumoylation of MEL1S at lysine 568 and its interaction with CtBP facilitates its repressor activity and the blockade of G-CSF-induced myeloid differentiation. Oncogene (0950-9232) 2011 imex curation Nishikata I., Nakahata S., Saito Y., Kaneda K., Ichihara E., Yamakawa N., Morishita K. Cancer - Interactions investigated in the context of cancer MEL1 has been entered as isoform-2, as identified from Mochizuki-2000 and Nishikata -2003 Blood. kmorishi@med.miyazaki-u.ac.jp 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nishikata I., Nakahata S., Saito Y., Kaneda K., Ichihara E., Yamakawa N., Morishita K. Cancer - Interactions investigated in the context of cancer MEL1 has been entered as isoform-2, as identified from Mochizuki-2000 and Nishikata -2003 Blood. kmorishi@med.miyazaki-u.ac.jp Accepted 2011-DEC-15 by MGT Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Sumoylation of MEL1S at lysine 568 and its interaction with CtBP facilitates its repressor activity and the blockade of G-CSF-induced myeloid differentiation. Sumoylation of MEL1S at lysine 568 and its interaction with CtBP facilitates its repressor activity and the blockade of G-CSF-induced myeloid differentiation. Oncogene (0950-9232) 2011 imex curation Nishikata I., Nakahata S., Saito Y., Kaneda K., Ichihara E., Yamakawa N., Morishita K. Cancer - Interactions investigated in the context of cancer MEL1 has been entered as isoform-2, as identified from Mochizuki-2000 and Nishikata -2003 Blood. kmorishi@med.miyazaki-u.ac.jp 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nishikata I., Nakahata S., Saito Y., Kaneda K., Ichihara E., Yamakawa N., Morishita K. Cancer - Interactions investigated in the context of cancer MEL1 has been entered as isoform-2, as identified from Mochizuki-2000 and Nishikata -2003 Blood. kmorishi@med.miyazaki-u.ac.jp Accepted 2011-DEC-15 by MGT 14-Mar-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database q9haz2-2 Histone-lysine N-methyltransferase PRDM16 MEL1L PRDM16 KIAA1675 MEL1 PFM13 PR domain-containing protein 16 Transcription factor MEL1 PR domain zinc finger protein 16 protein protein human Homo sapiens Human MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDFTPKEGSPYEAPVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAAAKETDFGWEQILTDVEVSPQEGCITKISEDLGSEKFCVDANQAGAGSWLKYIRVACSCDDQNLTMCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQHMVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLNHASLGFNEYFPSRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDPDKDKGKGKSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIAEKYFGPGFMGMQEKKLGSLPYHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQGSLDAWLKVTGATSESGAFHPINHL No experimental confirmation available. 1CB045F5BBFE9D20 q9haz2-4 Histone-lysine N-methyltransferase PRDM16 MEL1S PRDM16 KIAA1675 MEL1 PFM13 PR domain-containing protein 16 Transcription factor MEL1 PR domain zinc finger protein 16 protein protein human Homo sapiens Human MCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQHMVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLNHASLGFNEYFPSRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDPDKDKGKGKSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIAEKYFGPGFMGMQEKKLGSLPYHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSAIETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDAWLKVTGATSESGAFHPINHL Produced by alternative promoter usage. 7A24088D0A73B54F hdac2_chick Histone deacetylase 2 HDAC2 protein protein chick Gallus gallus (Chicken) Chicken MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSEVSMVNNFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDTKGAKSEQLSNP 4F79B9C0D4A2D065 ctbp2_mouse C-terminal-binding protein 2 Ctbp2 protein protein mouse Mus musculus Mouse MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPPAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ 5A81B9D75A9E493B ctbp2-prdm16 1 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b prdm16-ctbp2 1 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b ctbp2-prdm16-1 1 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey Q9HAZ2-4:p.[Asp590_Leu591delinsAlaSer;Asp620_Leu621delinsAlaSer] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain DL AS certain certain sequence position certain certain certain sequence position certain DL AS Wed May 02 19:42:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_leu590-591ala_ser,asp_leu620-621ala_ser' Tue Jun 30 18:19:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp590_Leu591delinsAlaSer;Asp620_Leu621delinsAlaSer]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b prdm16-ctbp2-1 1 4 unspecified role unspecified role bait bait Q9HAZ2-4:p.[Asp590_Leu591delinsAlaSer;Asp620_Leu621delinsAlaSer] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain DL AS certain certain sequence position certain certain certain sequence position certain DL AS Wed May 02 15:11:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_leu590-591ala_ser,asp_leu620-621ala_ser' Tue Jun 30 17:11:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp590_Leu591delinsAlaSer;Asp620_Leu621delinsAlaSer]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3b hdac2-prdm16 2 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9HAZ2-4:p.[Lys568Arg;Asp590Ala;Leu591Ser;Leu619Ser;Asp620Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 11:01:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys568arg,asp590ala,leu591ser,asp619ala,leu620ser' Wed May 02 19:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys568arg,asp590ala,leu591ser,leu619ser,asp620ala' Tue Jun 30 17:47:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys568Arg;Asp590Ala;Leu591Ser;Leu619Ser;Asp620Ala]' Q9HAZ2-4:p.Lys568Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:53:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys568arg' Tue Jun 30 16:39:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys568Arg' Q9HAZ2-4:p.[Asp590Ala;Leu591Ser;Asp620Ala;Leu621Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 10:55:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp590ala,leu591ser,asp619ala,leu620ser' Wed May 02 14:57:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp590ala,leu591ser,asp620ala,leu621ser' Tue Jun 30 18:13:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp590Ala;Leu591Ser;Asp620Ala;Leu621Ser]' physical association physical association 6b