I2D I2D Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3ɛ. Oncogene (0950-9232) 2011 imex curation Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu 26-Sep-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Barbash O., Lee EK., Diehl JA. Cancer - Interactions investigated in the context of cancer Fbx4 has been entered as human based on the sequence given in Fig 2b. adiehl@mail.med.upenn.edu Accepted 2011-JUN-22 by MGT 26-Sep-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database 1433e_rat 14-3-3 protein epsilon Ywhae Mitochondrial import stimulation factor L subunit protein protein rat Rattus norvegicus (Rat) Rat MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62260 original sequence version: 67 07817CCBD1F75B26 fbx4_mouse F-box only protein 4 Fbxo4 Fbx4 protein protein mouse Mus musculus Mouse MAGSEPRGAGSPPPASDWGRLEAAILSGWRTFWYSVAKERATPTASRKEAAEETSALTRLPVDVQLYILSFLSPHDLCQLGSTDHYWNKTIRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDSTCLDYMEVYKMCCPYTRRALKASRPMYGVVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEDLCPTAGLPHRQIDGIGSGVNFQLNNQQKFNILILYSTTRKERDRAREEHTSTVNKMFSLQSEGDEQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHRRHEWQDEFSRIMAMTDPAFGSSGRPMLVLSCISQADVKRMPCFYLAHELHLSLLNHPWMVQDTEAETLTGFLNGIEWILEEVESKRAK 36D78194EAF9EE95 fbx4_human F-box only protein 4 FBXO4 FBX4 protein protein human Homo sapiens Human MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAR BD5E8DD14B9733E9 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 07817CCBD1F75B26 skp1_human S-phase kinase-associated protein 1 SKP1 EMC19 OCP2 SKP1A TCEB1L Cyclin-A/CDK2-associated protein p19 p19skp1 RNA polymerase II elongation factor-like protein Organ of Corti protein 2 Organ of Corti protein II SIII Transcription elongation factor B polypeptide 1-like protein protein human Homo sapiens Human MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK C794D62AFB75528A fbxo4-ywhae 6 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKT5:p.Ser8Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S R Wed May 02 16:59:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser8arg' Tue Jun 30 17:34:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser8Arg' physical association physical association 2a fbxo4-ywhae-1 5 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait Q9UKT5:p.Ser8Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S R Wed May 02 14:26:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser8arg' Tue Jun 30 17:18:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser8Arg' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKT5:p.Ser12Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:08:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser12ala' Tue Jun 30 19:51:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser12Ala' physical association physical association 2c, 3d 14-3-3epsilon interaction with Fbx4 can be disrupted by a kinase-dead GSK3beta. Kinase dead GSK3beta fbxo4-ywhae-3 7 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKT5:p.Ser8Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S R Wed May 02 16:50:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser8arg' Tue Jun 30 19:28:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser8Arg' Q9UKT5:p.Ser12Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:59:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser12ala' Tue Jun 30 19:12:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser12Ala' physical association physical association 2d fbxo4-skp1 7 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKT5:p.Ser12Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S E Wed May 02 19:06:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser12glu' Tue Jun 30 16:44:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser12Glu' 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association 2e 2d 2d ywhae-fbxo4 1 10 unspecified role unspecified role prey prey Q9UKT5:p.Ser8Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S R Wed May 02 16:16:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser8arg' Tue Jun 30 15:54:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser8Arg' Q9UKT5:p.Ser12Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:15:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser12ala' Tue Jun 30 18:16:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser12Ala' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role bait bait P62260:p.Lys50Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:30:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys50glu' Tue Jun 30 19:19:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys50Glu' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2f,g fbx4-ywhae 4 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 3a, 3c Association of Fbx4 with 14-3-3epsilon occurs only at G1/S and S phases of the cell cycle. GSK3beta inhibitor, SB, reduced phosphorylation of Fbx4 at Ser12 and reduced concomitant binding to 14-3-3epsilon. ywhae-fbx4 4 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 3a Association of Fbx4 with 14-3-3epsilon occurs only at G1/S and S phases of the cell cycle. fbxo4-ywhae-4 3 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 3b Association of Fbx4 with 14-3-3epsilon occurs only at G1/S and S phases of the cell cycle. fbxo4-fbxo4 2 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey association association 5a Knockdown of 14-3-3epsilon with shRNAs reduces co-precipitation of Flag-Fbx4 with Myc-Fbx4. fbxo4-fbxo4-2 2 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5c Overexpression of 14-3-3epsilon increases dimerization of Fbx4