I2D I2D Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Oncogene (0950-9232) 2011 imex curation Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de Accepted 2012-FEB-10 by JYOTI Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Oncogene (0950-9232) 2011 imex curation Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Glycogen synthase kinase-3β is a crucial mediator of signal-induced RelB degradation. Oncogene (0950-9232) 2011 imex curation Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Neumann M., Klar S., Wilisch-Neumann A., Hollenbach E., Kavuri S., Leverkus M., Kandolf R., Brunner-Weinzierl M.C., Klingel K. Cancer - Interactions investigated in the context of cancer Author confirms that GST-IkappaBalpha construct is human. manfred.neumann@med.uni-tuebingen.de Accepted 2012-FEB-10 by JYOTI 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE DIP protein Q9Y6K9 original sequence version: 85 DIP protein Q9Y6K9 original sequence version: 118 DIP protein Q9Y6K9 original sequence version: 123 DIP protein Q9Y6K9 original sequence version: 141 DIP protein Q9Y6K9 original sequence version: 125 DIP protein Q9Y6K9 original sequence version: 156 DIP protein Q9Y6K9 original sequence version: 83 DIP protein Q9Y6K9 original sequence version: 132 DIP protein Q9Y6K9 original sequence version: 124 DIP protein Q9Y6K9 original sequence version: 90 322D1037881447FF tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 relb_human Transcription factor RelB RELB I-Rel protein protein human Homo sapiens Human MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT C2C61C2C8640513E gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 gsk3b-relb 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 4c ikbkg-nfkbia 1 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation 4b rela-nfkbia-6 1 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation 4b gsk3b-relb-2 2 6 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser552 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation 4d gsk3b-relb-4 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 4c relb-gsk3b 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4c gsk3b-rela 3 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 3c