I2D I2D Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-wt7 Human WT7 cells (786-O renal carcinoma cells expressing pRc/CMV-HA-VHL) wt7 Homo sapiens WT7 cells (786-O renal carcinoma cells expressing pRc/CMV-HA-VHL) CRL-1932 is the ATCC identifier for 786-O cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion western blot western blot Immuno blot Immuno blot Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Hypoxia and cell cycle regulation of the von Hippel-Lindau tumor suppressor. Oncogene (0950-9232) 2011 imex curation Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer gnarrajr@upmc.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu W., Xin H., Eckert DT., Brown JA., Gnarra JR. Cancer - Interactions investigated in the context of cancer A derivative of 786-O cell line was used for these experiments. A VHL-negative 786-O cell line was tranduced with a retrovirus construct expressing a C-terminally FLAG-tagged VHL cDNA to make 786-O G7F cell line. gnarrajr@upmc.edu Accepted 2011-JAN-24 by ORCHARD 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2011 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA p40337-3 von Hippel-Lindau disease tumor suppressor VHL19 VHLp18(MEA) VHL Protein G7 pVHL protein protein human Homo sapiens Human MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Produced by alternative initiation at Met-54 of isoform 1. 2644C3B8C3A87D64 fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR DIP protein Q9UM11 original sequence version: 100 DIP protein Q9UM11 original sequence version: 131 DIP protein Q9UM11 original sequence version: 136 DIP protein Q9UM11 original sequence version: 145 F6C8FDAF81D8103A p40337-1 von Hippel-Lindau disease tumor suppressor VHL Protein G7 pVHL VHL30 VHLp24(MPR) protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Major isoform. BA5D6765FBC16EA7 cdh1-vhl 4 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig. 5a Identity of VHL as p19 is made on the basis of molecular weight and previous identification of this as the major isoform expressed in this cell type. cdh1-vhl-1 5 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 5b cdh1-vhl-2 6 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association Fig. 5c cdh1-vhl-3 1 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association Fig. 5d fzr1-p40337_1-1 2 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40337-1:p.[Arg60Ala;Leu63Ala;Asn67Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain N A certain certain sequence position certain certain certain sequence position certain R A Fri Jul 22 10:54:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu63ala,asn67ala,arg60ala' Wed May 02 20:30:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg60ala,leu63ala,asn67ala' Tue Jun 30 18:16:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg60Ala;Leu63Ala;Asn67Ala]' physical association physical association Fig. 6e cdh1-cdc27-3 3 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. S2