IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Cancer Cell (1535-6108) 2010 imex curation Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Species of molecules used confirmed by the authors. Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Accepted 2010-Not a month!-10 by JYOTI. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Cancer Cell (1535-6108) 2010 imex curation Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Immunoprecipitates were captured by Protein-A and western blotted with anti-FLAG antibody. Species of molecules used confirmed by the authors. Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Accepted 2010-Not a month!-10 by JYOTI. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Double antiangiogenic protein, DAAP, targeting VEGF-A and angiopoietins in tumor angiogenesis, metastasis, and vascular leakage. Cancer Cell (1535-6108) 2010 imex curation Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Koh YJ., Kim HZ., Hwang SI., Lee JE., Oh N., Jung K., Kim M., Kim KE., Kim H., Lim NK., Jeon CJ., Lee GM., Jeon BH., Nam DH., Sung HK., Nagy A., Yoo OJ., Koh GY. Cancer - Interactions investigated in the context of cancer I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). I have made the "daap" molecules as a fusion protein with an Fc tag. -originally I added the Fc component to the fusion protein, but as it seems to be used as a Tag I have entered it as a feature. (the amino acids for VEGFR1 are NOT stated in the paper, nor for the Fc region). BAITS added as the molecule added to the wells first (mostly). Species of molecules used confirmed by the authors. gykoh@kaist.ac.kr Accepted 2010-Not a month!-10 by JYOTI. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 jyoti Only protein-protein interactions imex curation p15692-4 Vascular endothelial growth factor A VEGF VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein P15692-4 original sequence version: 150 CCE57097DD3779BD tie2_human Angiopoietin-1 receptor TEK TIE2 Tyrosine-protein kinase receptor TIE-2 Tyrosine-protein kinase receptor TEK Tunica interna endothelial cell kinase p140 TEK Endothelial tyrosine kinase Tyrosine kinase with Ig and EGF homology domains-2 VMCM VMCM1 protein protein human Homo sapiens Human MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA DIP protein Q02763 original sequence version: 123 DIP protein Q02763 original sequence version: 79 E739DEC3E4FEB124 p15692-2 Vascular endothelial growth factor A VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR 7B9759AD5871FF33 pigf_mouse Phosphatidylinositol-glycan biosynthesis class F protein Pigf protein protein mouse Mus musculus Mouse MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN BD78A77E69C5BC1E daap-5 Human f usion protein: Ig2 domain from VEGFR1, and Tie2 aas 1-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt angp1_human Angiopoietin-1 ANGPT1 KIAA0003 protein protein human Homo sapiens Human MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF 5D5FA63AEF6BE920 angp4_mouse Angiopoietin-4 Angpt4 Agpt4 Ang3 Angiopoietin-3 protein protein mouse Mus musculus Mouse MLCQPAMLLDGLLLLATMAAAQHRGPEAGGHRQIHQVRRGQCSYTFVVPEPDICQLAPTAAPEALGGSNSLQRDLPASRLHLTDWRAQRAQRAQRVSQLEKILENNTQWLLKLEQSIKVNLRSHLVQAQQDTIQNQTTTMLALGANLMNQTKAQTHKLTAVEAQVLNQTLHMKTQMLENSLSTNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQLNSLQEKREQLHSLLGHQTGTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQDQHPVSLKTPKPVFQDCAEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVNFQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRYSLSVNDSSSSAGRKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYSVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRPMGA 9B5A74A20A6664F6 daap-4 Human fusion protein: Ig2 and Ig3 domains from VEGFR1, and Tie2 aas 1-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt vegf_trap Human fusion protein: VEGF-TRAP: (Ig2) of VEGFR1 and (Ig3) of VEGFR2 protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt daap-7 Human f usion protein: Ig2 domain from VEGFR1 and Tie2 aas 122-348. protein protein human Homo sapiens Human An amino acid sequence which is not represented in UniProt angp2_human Angiopoietin-2 ANGPT2 protein protein human Homo sapiens Human MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF 5642A58847A7385C angp4_human Angiopoietin-4 ANGPT4 ANG3 ANG4 Angiopoietin-3 protein protein human Homo sapiens Human MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGASASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI 79CE52F66B532340 p15692-9 Vascular endothelial growth factor A VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR No experimental confirmation available. DDF4D6994249BED6 q00731-2 Vascular endothelial growth factor A VEGF164 Vegfa Vegf Vascular permeability factor protein protein mouse Mus musculus Mouse MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR 7B0BE0B9541E3805 angp2_mouse Angiopoietin-2 Angpt2 Agpt2 protein protein mouse Mus musculus Mouse MWQIIFLTFGWDLVLASAYSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF E7563B498A0EF331 vegfa-daap4 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. VEGFA is not explicitly stated to be tagged nor CHO cell derived. ang2-daap4 1 11 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B, S1A. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. daap5-h_vegfa165 2 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Fig 1C. vegfa-daap5 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B, 1D. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. Affinity constant for VEGFA165/DAAP-5 binding is ~4.6pM. VEGFA is not explicitly stated to be tagged nor CHO cell derived. vegfa-daap7 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 13 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. VEGFA is not explicitly stated to be tagged nor CHO cell derived. ang2-daap5 1 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B, S1A, 1E. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. Affinity constant for Ang2/DAAP-5 binding is ~10pM. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. ang2-tie2_122-213 1 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1B, S1A. DAAP-4 and DAAP-5 were capable of binding both VEGF-A and Ang-2, wheras DAAP-7 only bound to VEGFA. The Tie2 (Ig2 domain+Fc) also weakly binds to Ang-2. no interpro domain found for Tie2 aas 122-213. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. daap5-m_vegfa164 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction VEGF164 =Isoform VEGF-1 (identifier: Q00731-2) Fig 1C. daap5-h_vegfa189 2 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Isoform VEGF189 (identifier: P15692-2) Fig 1C. daap5-h_vegfa121 2 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Isoform VEGF121 (identifier: P15692-9) Fig 1C. daap5-mpigf 2 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. daap5-hang2 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. daap5-h_mang2 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction Fig 1C. daap5-h_ang1 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction Fig 1C. daap5-m_ang3 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction ang 3 in this paper must be UniProt Ang-4.... Fig 1C. daap5-hang4 2 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction Fig 1C. vt-h_vegfa165-1 2 12 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. vt-m_vegfa164-1 2 17 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction VEGF164 =Isoform VEGF-1 (identifier: Q00731-2) Fig 1C. vt-h_vegfa189-1 2 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Isoform VEGF189 (identifier: P15692-2) Fig 1C. vt-h_vegfa121-1 2 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Isoform VEGF121 (identifier: P15692-9) Fig 1C. vt-mpigf-1 2 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 12 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. tie2-hang2 2 5 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. tie2-h_mang2-1 2 18 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 5 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. tie2-h_ang1-1 2 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 5 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1C. tie2-m_ang3-1 2 5 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction ang 3 in this paper must be UniProt Ang-4.... Fig 1C. tie2-hang4-1 2 5 unspecified role unspecified role bait bait n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction Fig 1C. vegfa165-vt 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 12 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1D, S1I. Affinity constant for VEGFA165/VEGF-Trap binding is ~1.7pM. The VEGFA is not explicitly stated to be flag-tagged nor CHO cell derived. hang2-tie2 1 5 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig 1E, S1J. Affinity constant for Tie2-Fc/ang2 binding is ~50pM. T2 - Tie 2 - check it is aas 1-348. Ang-2 is not explicitly stated to be tagged nor CHO cell derived. vegfa165-vt-1 3 12 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the VEGFA isoform used, nor its origin, nor if VEGFA is tagged or not. vegfa-daap5-1 3 8 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the VEGFA isoform used, nor its origin, nor if VEGFA is tagged or not. ang2-tie2-1 3 5 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the origin of Ang-2, nor if it is tagged or not. ang2-daap5-1 3 8 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction Fig S1D. The binding affinity of DAAP to VEGF-A is roughly three times lower than that of VEGF-Trap to VEGF-A, whereas the binding affinity of DAAP to Ang-2 is roughly five times higher than that of Tie2-Fc to Ang-2. BIAcore analyses showed similar results (Figure S1D). The authors have not confirmed the origin of Ang-2, nor if it is tagged or not. daap5-hang2-vegfa 1 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role bait bait fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig S1 I-J. Preoccupation of one binding site on DAAP with VEGF-A or Ang-2 further enhanced its binding activity to the other ligand- Ang-2 or VEGF-A. I think this is the best/easiest (?)way to enter this interaction - with DAAP as the bait: though as the plates were not coated with DAAP it maybe should not be...However DAAP was preincubated with Ang-2 or VEGF-A... Neither VEFGA nor Ang-2 are explicitly stated to be tagged or CHO cell derived. vegfa-daap-flag_ang2 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role prey prey fc c terminus C terminal Fc tag from human IgG1 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig S1 L. DAAP is capable of simultaneously binding VEGF-A and Ang-2.