I2D I2D PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. Oncogene (0950-9232) 2010 imex curation Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn Accepted 2010-Not a month!-14 by ORCHARD. 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. Oncogene (0950-9232) 2010 imex curation Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn Accepted 2010-Not a month!-14 by ORCHARD. 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. PIASy stimulates HIF1? SUMOylation and negatively regulates HIF1? activity in response to hypoxia. Oncogene (0950-9232) 2010 imex curation Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang X., Li J., Zou Y., Yi J., Zhang H., Cao M., Yeh ET., Cheng J. Cancer - Interactions investigated in the context of cancer Author confirms that all constructs used were of human origin. jkcheng@shsmu.edu.cn Accepted 2010-Not a month!-14 by ORCHARD. 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 pias4_human E3 SUMO-protein ligase PIAS4 Protein inhibitor of activated STAT protein gamma PIASy PIAS4 PIASG Protein inhibitor of activated STAT protein 4 RING-type E3 ubiquitin transferase PIAS4 protein protein human Homo sapiens Human MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDEDEEGPRPKRRCPFQKGLVPAC DIP protein Q8N2W9 original sequence version: 122 26AAA18246E1ACE3 o75928-2 E3 SUMO-protein ligase PIAS2 Msx-interacting zinc finger protein PIAS-NY protein Protein inhibitor of activated STAT x Protein inhibitor of activated STAT2 PIAS2 PIASX Androgen receptor-interacting protein 3 DAB2-interacting protein PIASx-alpha ARIP3 E3 SUMO-protein transferase PIAS2 protein protein human Homo sapiens Human MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQEDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGEQRRNDINNELKLGTSSDTVQQ Contains a glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) at position 562. 63106D68C585F0ED hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT DIP protein Q99814 original sequence version: 115 DIP protein Q99814 original sequence version: 155 DIP protein Q99814 original sequence version: 157 DIP protein Q99814 original sequence version: 137 DIP protein Q99814 original sequence version: 135 4838989598234FC1 sumo1-hif1a 2 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.Lys719Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K T Wed May 02 18:46:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys719thr' Tue Jun 30 20:15:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys719Thr' 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1b,c, 2b, 3e, S2, S5 piasy-hif1a 2 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.Lys719Thr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K T Wed May 02 16:16:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys719thr' Tue Jun 30 19:13:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys719Thr' region PIASy binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2a, c, 3a sumo1-hif1a-1 1 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 1d, e piasy-hif1a-1 3 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association Fig. 2d piasy-hif1a-2 2 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region HIF1alpha binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3b, c sumo1-hif2a 2 4 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4a sumo1-hif2a-1 2 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4b