I2D I2D The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction. The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction. Oncogene (0950-9232) 2010 imex curation Nagasaka K., Pim D., Massimi P., Thomas M., Tomaic V., Subbaiah VK., Kranjec C., Nakagawa S., Yano T., Taketani Y., Myers M., Banks L. Cancer - Interactions investigated in the context of cancer Additional details of construct obtained from manufacturer's website. Author confirms PDZ1-C construct to be from amino acids 731-1630, C-terminal KIM site is 1399/1400 not 1396/1397and N-terminal KIM site is 839/840 not 836/837. nagasaka@icgeb.org banks@icgeb.org 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Nagasaka K., Pim D., Massimi P., Thomas M., Tomaic V., Subbaiah VK., Kranjec C., Nakagawa S., Yano T., Taketani Y., Myers M., Banks L. Cancer - Interactions investigated in the context of cancer Additional details of construct obtained from manufacturer's website. Author confirms PDZ1-C construct to be from amino acids 731-1630, C-terminal KIM site is 1399/1400 not 1396/1397and N-terminal KIM site is 839/840 not 836/837. nagasaka@icgeb.org nagasaka@icgeb.org Accepted 2010-Not a month!-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction. The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction. Oncogene (0950-9232) 2010 imex curation Nagasaka K., Pim D., Massimi P., Thomas M., Tomaic V., Subbaiah VK., Kranjec C., Nakagawa S., Yano T., Taketani Y., Myers M., Banks L. Cancer - Interactions investigated in the context of cancer Additional details of construct obtained from manufacturer's website. Author confirms PDZ1-C construct to be from amino acids 731-1630, C-terminal KIM site is 1399/1400 not 1396/1397and N-terminal KIM site is 839/840 not 836/837. nagasaka@icgeb.org banks@icgeb.org 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nagasaka K., Pim D., Massimi P., Thomas M., Tomaic V., Subbaiah VK., Kranjec C., Nakagawa S., Yano T., Taketani Y., Myers M., Banks L. Cancer - Interactions investigated in the context of cancer Additional details of construct obtained from manufacturer's website. Author confirms PDZ1-C construct to be from amino acids 731-1630, C-terminal KIM site is 1399/1400 not 1396/1397and N-terminal KIM site is 839/840 not 836/837. nagasaka@icgeb.org nagasaka@icgeb.org Accepted 2010-Not a month!-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Oncogene (0950-9232) 2010 orchard Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E scrib_human Protein scribble homolog SCRIB CRIB1 KIAA0147 LAP4 SCRB1 VARTUL Protein LAP4 protein protein human Homo sapiens Human MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQPPPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPSAEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKEEEEEEEGSPQEEEVEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERRGGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLPHSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAALEVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRGLQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQAYRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRPGRRGLGPVPS DIP protein Q14160 original sequence version: 104 DIP protein Q14160 original sequence version: 139 D71E024FBC4F72D1 mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP DIP protein P27361 original sequence version: 171 DIP protein P27361 original sequence version: 101 DIP protein P27361 original sequence version: 124 DIP protein P27361 original sequence version: 129 DIP protein P27361 original sequence version: 143 E6020CE413EC41F7 erk1-scrib 1 4 enzyme target enzyme target substrate substrate bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14160:p.[Ser853Ala;Ser1448Ala] Alters kinetics of interaction mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 10:58:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1448ala,ser853ala' Wed May 02 17:24:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser853ala,ser1448ala' Tue Jun 30 16:37:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser853Ala;Ser1448Ala]' Q14160:p.Ser853Ala Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:29:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser853ala' Tue Jun 30 16:19:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser853Ala' Q14160:p.Ser1448Asp Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain S D Wed May 02 14:36:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1448asp' Tue Jun 30 18:00:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1448Asp' Q14160:p.Ser1448Ala Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:21:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1448ala' Tue Jun 30 18:40:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1448Ala' Q14160:p.[Arg839_Arg840delinsAlaAla;Lys1399_Arg1400delinsAlaAla] arg839ala-arg840ala-lys1399ala-arg1400ala Alters kinetics of interaction mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain RR AA certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:18:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg839ala-arg1400ala Fri Jul 22 11:13:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg839ala,arg840ala,lys1399ala,arg1400ala' Wed May 02 19:45:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg839-840ala_ala,lys_arg1399-1400ala_ala' Tue Jun 30 18:17:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg839_Arg840delinsAlaAla;Lys1399_Arg1400delinsAlaAla]' Q14160:p.Lys1399_Arg1400delinsAlaAla lys1399ala-arg1400ala Alters kinetcs of interaction mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:17:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys1399_arg1400ala Fri Jul 22 11:09:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1399ala,arg1400ala' Wed May 02 15:14:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg1399-1400ala_ala' Tue Jun 30 17:44:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1399_Arg1400delinsAlaAla' 5 enzyme enzyme prey prey phosphorylation phosphorylation reaction phosphorylation Fig 4a, c erk2-scrib-1 1 4 enzyme target enzyme target substrate substrate bait bait region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 enzyme enzyme prey prey direct interaction direct interaction Fig 4a erk1-scrib-2 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q14160:p.Lys1399_Arg1400delinsAlaAla lys1399ala-arg1400ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain KR AA Thu Jul 07 12:17:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was lys1399ala-arg1400al Fri Jul 22 10:54:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1399ala,arg1400ala' Wed May 02 19:02:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys_arg1399-1400ala_ala' Tue Jun 30 20:26:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1399_Arg1400delinsAlaAla' arg839ala-arg1400ala arg839ala-arg840ala-lys1399ala-arg1400ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Q14160:p.Arg839_Arg840delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain RR AA Thu Jul 07 12:17:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg839ala-arg840ala Fri Jul 22 10:54:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg839ala,arg840ala' Wed May 02 15:32:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_arg839-840ala_ala' Tue Jun 30 19:15:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg839_Arg840delinsAlaAla' 5 unspecified role unspecified role prey prey direct interaction direct interaction Fig 5a