IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-h727 Homo sapiens bronchial carcinoid line. h727 Human bronchial carcinoid line. The cells are able to synthesize the peptide NMB, but not the gastrin releasing peptide (GRP). They secrete a parathyroid hormone-like protein which is calcium stimulated through a protein kinase C pathway. Also known as NCI-H727 or CRL-5815.. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-h358 Homo sapiens Caucasian bronchioalveolar carcinoma h358 Human Caucasian bronchioalveolar carcinoma Also known as NCI-H358. H358 cells secrete a high level of amphiregulin that, in combination with IGF1, prevents serum deprivation apoptosis. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. GST-SH2/3 constructs were transiently expressed and pulled-down with glutathione-Sepharose 4B, followed by an in vitro kinase assay on the pellets. Additional detail on enzyme taken from manufacturer's website. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion pull down pull down western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-h520 Homo sapiens h520 lung squamous cell carcinoma h520 h520 human lung squamous cell carcinoma A hypotriploid human cell line. Also known as NCBI-H520 or HTB-182. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-h520 Homo sapiens h520 lung squamous cell carcinoma h520 h520 human lung squamous cell carcinoma A hypotriploid human cell line. Also known as NCBI-H520 or HTB-182. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 mouse-3t3src Mouse src transformed embryo fibroblast cells 3t3src Mouse src transformed embryo fibroblast cells Rous-sarcoma virus transformed 3T3 (3T3src containing v-src) cells ,G418 resistant. These cells over-express Src. pull down pull down western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-mel_553b Homo sapiens metastic melanome cell line mel_553b Human metastic melanome cell line Expresses endogenous E-cadherin anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. The Tensin-3 protein, including its SH2 domain, is phosphorylated by Src and contributes to tumorigenesis and metastasis. Cancer Cell (1535-6108) 2009 imex curation Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions 29 human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Qian X., Li G., Vass WC., Papageorge A., Walker RC., Asnaghi L., Steinbach PJ., Tosato G., Hunter K., Lowy DR. Cancer - Interactions investigated in the context of cancer EBI-2607577 moved to expt 16, EBI-2608382 to Expt 17, EBI-2608145 moved to Expt 9 - as a Far Western. lowyd@mail.nih.gov Accepted 2010-MAY-7 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 29 imex curation tens3_human Tensin-3 TNS3 TEM6 TENS1 TPP Tumor endothelial marker 6 Tensin-like SH2 domain-containing protein 1 protein protein human Homo sapiens Human MEEGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLVLNLSEKRYDLTKLNPKIMDVGWPELHAPPLDKMCTICKAQESWLNSNLQHVVVIHCRGGKGRIGVVISSYMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFLHFVILHGTPNFDTGGVCRPFLKLYQAMQPVYTSGIYNVGPENPSRICIVIEPAQLLKGDVMVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKDDRFPDYGKVELVFSATPEKIQGSEHLYNDHGVIVDYNTTDPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKKSSSDPGIPGGPQAIPATNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQEKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDDEMPHHDLHSVDSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEARLVSRCPADNPGLVQAQPRVPLTPTRGTSSRVAVQRGVGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSVSPDSVGGGLRASSRLPDTGEGPSRATGRQGSSAEQPLGGRLRKLSLGQYDNDAGGQLPFSKCAWGKAGVDYAPNLPPFPSPADVKETMTPGYPQDLDIIDGRILSSKESMCSTPAFPVSPETPYVKTALRHPPFSPPEPPLSSPASQHKGGREPRSCPETLTHAVGMSESPIGPKSTMLRADASSTPSFQQAFASSCTISSNGPGQRRESSSSAERQWVESSPKPMVSLLGSGRPTGSPLSAEFSGTRKDSPVLSCFPPSELQAPFHSHELSLAEPPDSLAPPSSQAFLGFGTAPVGSGLPPEEDLGALLANSHGASPTPSIPLTATGAADNGFLSHNFLTVAPGHSSHHSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSGFSSPHSGSTISIPFPNVLPDFSKASEAASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPKKV 40B02C6269899320 src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P12931 original sequence version: 188 DIP protein P12931 original sequence version: 189 DIP protein P12931 original sequence version: 190 DIP protein P12931 original sequence version: 191 DIP protein P12931 original sequence version: 115 DIP protein P12931 original sequence version: 116 DIP protein P12931 original sequence version: 164 DIP protein P12931 original sequence version: 142 DIP protein P12931 original sequence version: 143 DIP protein P12931 original sequence version: 150 DIP protein P12931 original sequence version: 160 DIP protein P12931 original sequence version: 184 DIP protein P12931 original sequence version: 155 DIP protein P12931-1 original sequence version: 155 DIP protein P12931 original sequence version: 202 C1908084683E5DE8 khdr1_mouse KH domain-containing, RNA-binding, signal transduction-associated protein 1 p21 Ras GTPase-activating protein-associated p62 GAP-associated tyrosine phosphoprotein p62 Src-associated in mitosis 68 kDa protein p68 Khdrbs1 protein protein mouse Mus musculus Mouse MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGGPRGGARASPATQPPPLLPPSTPGPDATVVGSAPTPLLPPSATAAVKMEPENKYLPELMAEKDSLDPSFTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVSVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGSITRGATVTRGVPPPPTVRGAPTPRARTAGIQRIPLPPTPAPETYEDYGYDDTYAEQSYEGYEGYYSQSQGESEYYDYGHGELQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY D33DE960BEA9E5AA khdr1_human KH domain-containing, RNA-binding, signal transduction-associated protein 1 SAM68 Src-associated in mitosis 68 kDa protein KHDRBS1 p21 Ras GTPase-activating protein-associated p62 GAP-associated tyrosine phosphoprotein p62 p68 protein protein human Homo sapiens Human MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGRY DIP protein Q07666 original sequence version: 55 DIP protein Q07666-1 original sequence version: 116 59FB4DB6FB4DBE98 cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 fak1_human Focal adhesion kinase 1 PTK2 FAK FAK1 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase Protein phosphatase 1 regulatory subunit 71 p125FAK protein protein human Homo sapiens Human MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH D8A4C15138AB0243 ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 rhg07_human Rho GTPase-activating protein 7 DLC1 ARHGAP7 KIAA1723 STARD12 Rho-type GTPase-activating protein 7 Deleted in liver cancer 1 protein StAR-related lipid transfer protein 12 START domain-containing protein 12 HP protein protein protein human Homo sapiens Human MSVAIRKRSWEEHVTHWMGQPFNSDDRNTACHHGLVADSLQASMEKDATLNVDRKEKCVSLPDCCHGSELRDFPGRPMGHLSKDVDENDSHEGEDQFLSLEASTETLVHVSDEDNNADLCLTDDKQVLNTQGQKTSGQHMIQGAGSLEKALPIIQSNQVSSNSWGIAGETELALVKESGERKVTDSISKSLELCNEISLSEIKDAPKVNAVDTLNVKDIAPEKQLLNSAVIAQQRRKPDPPKDENERSTCNVVQNEFLDTPCTNRGLPLLKTDFGSCLLQPPSCPNGMSAENGLEKSGFSQHQNKSPPKVKAEDGMQCLQLKETLATQEPTDNQVRLRKRKEIREDRDRARLDSMVLLIMKLDQLDQDIENALSTSSSPSGTPTNLRRHVPDLESGSESGADTISVNQTRVNLSSDTESTDLPSSTPVANSGTKPKTTAIQGISEKEKAEIEAKEACDWLRATGFPQYAQLYEDFLFPIDISLVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSDDSDEDEPCAISGKWTFQRDSKRWSRLEEFDVFSPKQDLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHAPPSEDAATPRTNSVISVCSSSNLAGNDDSFGSLPSPKELSSFSFSMKGHEKTAKSKTRSLLKRMESLKLKSSHHSKHKAPSKLGLIISGPILQEGMDEEKLKQLNCVEISALNGNRINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSACNKRVGMYLEGFDPFNQSTFNNVVEQNFKNRESYPEDTVFYIPEDHKPGTFPKALTNGSFSPSGNNGSVNWRTGSFHGPGHISLRRENSSDSPKELKRRNSSSSMSSRLSIYDNVPGSILYSSSGDLADLENEDIFPELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLDVDNDRTTPSDLDSTGNSLNEPEEPSEIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLNSVSLQINCQSVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPLTVNVQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNEGAIDCVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAAIMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGHLGNDDSADYQHFLQDCVDGLFKEVKEKFKGWVSYSTSEQAELSYKKVSEGPPLRLWRSVIEVPAVPEEILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLRTWRTNLPKGACALLLTSVDHDRAPVVGVRVNVLLSRYLIEPCGPGKSKLTYMCRVDLRGHMPEWYTKSFGHLCAAEVVKIRDSFSNQNTETKDTKSR DIP protein Q96QB1 original sequence version: 123 5D20F29CC606302E tens_chick Tensin TNS protein protein chick Gallus gallus (Chicken) Chicken MDFGSVMNQAATPCSPAVNYELPSPGQSITKQVDTPDATRSPRGGQAHCKASRSMSVTAAMESSCELDLVYITERIIAVSYPSTAEEQSFRSNLREVAHMLKSKHGDNYVLFNLSERRHDISKLHPKVLDFGWPDLHTPALEKICSICKAMDTWLNAAAHNVVVLHNKGNRGRLGVVVAAYMHYSNISASADQALDRFAMKRFYEDKVVPVGQPSQKRYIHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLKIYQAMQPVYTSGIYNVQGDSQTGICITIEPGLLLKGDILLKCYHKKFRSPTRDVIFRVQFHTCAVHDLDIVFGKEDLDEAFRDERFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYENFNIQREDSAEGTWAEPALPGKHLEKEVGHTQGPLDGSLYAKVKKKDSLHGSIGAVNTARLPLSAAPNHVEHTLSVSSDSGNSTASTKTDRTDEPGAPGAPTGHAVLSPEEKRDVDRLLVGFGLESAAPMHNHAPGPAPARLPAGPGRHVVPAQVHVNGAGTPLLAERETDILDDELPNQDGHSVGSLGTLSSLDGTTTASEAGFHEAPRVGSLSSLPNGPASYNGAEKMLKEGLYEAEPLSNGAYPYSNQNTLMGHHLRDPLAHLRPSRSAQEHLAGYPQRQPASASPAWLQPPVPQPYLYGYDLPSAHRSQSFPAVGTAKYEANLALPQAPARSTSSREAVQRGLNSWQQQGGSRPPSQLHDGGLESHSPSLSSCSPQPSPLQPMPPHSHSMPEFPRAPSRREIEQSIEALDVLMLDLAPSVHKSQSVPSAATRQDKPAAMLSSLSAQRLSGHYAQPTPQVVQPRSFGTSVGTDPLAKPYSPGPLVPAARSTAEPDYTVHEYRETYTPYSYQPVPEPRSYGSAPASILPLSASYSPAGSQQLLVSSPPSPTAPAQSQLPHKGLESYEDLSRSGEEPLNLEGLVAHRVAGVQSREKSPEESTVPARRRTPSDSHYEKSSPEPGSPRSPTVLSPEVVSTIAANPGGRPKEPHLHSYKEAFEEMESASPSSLTSGGVRSPPGLAKTPLSALGLKPHNPADILLHPVGELEGEAGADSEEEPRSYVESVARTATTGRAGNLPAAQPVGLEVPARNGAFGNSFTVPSPVSTSSPIHSVDGASLRSYPSEGSPHGTVTPPHAVAETAYRSPMVSQTPSAHSSYQTSSPSSFQAGTLGSPYASPDYPDGRGGFQPDPQARQQPQVSVVGVHALPGSPRTLHRTVATNTPPSPGFGRRAANPAVASVPGSPGLGRHTVSPHAPPGSPSLARHQMAAVPPGSPMYGYSSPEERRPTLSRQSSASGYQPPSTPSFPVSPAYYPGTSTPHSSSPDSAAYRQGSPTPQPALPEKRRMSAGERSNSLPNYATVNGKASSPLSSGMSSPSSGSAVAFSHTLPDFSKFSMPDISPETRANVKFVQDTSKYWYKPDISREQAIALLKDREPGAFIIRDSHSFRGAYGLAMKVASPPPTVMQQNKKGDITNELVRHFLIETSPRGVKLKGCPNEPNFGCLSALVYQHSIMPLALPCKLVIPDRDPMEEKKDAASTTNSATDLLKQGAACNVLFINSVEMESLTGPQAISKAVAETLVADPTPTATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWTKTDGSGPAKLFGFVARKQGSTTDNVCHLFAELDPDQPAAAIVNFVSRVMLGSGQKR DIP protein Q04205 original sequence version: 103 5C3C8B6211935524 bcar1_human Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas BCAR1 CAS CRKAS CASS1 Cas scaffolding protein family member 1 protein protein human Homo sapiens Human MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA DIP protein P56945 original sequence version: 113 DIP protein P56945 original sequence version: 116 B81EC3430049E795 src-tens3 7 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 2A. src-tens3-1 8 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. Phosphorylation of tensin 3. src-tens3-3 1 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. Phosphorylation of tensin 3. src-tens3-4 10 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. Phosphorylation of tensin 3. src-tens3-5 11 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. src-tens3-6 3 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. Phosphorylation of tensin 3. src-tens3-8 16 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A. src-tens3-9 2 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. src-tens3-10 15 17 unspecified role unspecified role bait bait 18 stimulator stimulator prey prey physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. src-tens3-11 3 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association Fig 2B. Tensin-3 phosphorylation depended upon Src as siRNA-induced knock down of Src in two NSCLC lines, H358 and A549, resulted in almost complete loss of tensin-3 phosphotyrosine. src-tens3-12 10 17 unspecified role unspecified role bait bait region (possible) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey association association Fig 2B. Tensin-3 phosphorylation depended upon Src as siRNA-induced knock down of Src in two NSCLC lines, H358 and A549, resulted in almost complete loss of tensin-3 phosphotyrosine. Phosphorylation of Tensin-3 src-tens3-16 13 17 stimulator stimulator bait bait 18 unspecified role unspecified role prey prey physical association physical association Fig 2A. Hyperphosphorylation of tensin 3 is correlated with Src activity in cancer cell lines. fak-tens3-1 4 22 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 3A. Endogenous Tensin-3 in A549 cells partially colocalizes with endogenous vinculin (a marker of focal adhesions), p130Cas, and FAK. bcar1-tens3-10 4 17 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role neutral component neutral component tyr-410 (required) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain colocalization colocalization Fig 3B. Src activity is required for efficient colocalization of Tensin-3 with pp130Cas. Treatment with PP2 decreased the amount of p130Cas recognized by the pY410 antibody or colocalized with transfected GFP-tensin-3. PP2-an inhibitor of the Src family tyrosine kinases. bcar1-tens3-1 3 26 unspecified role unspecified role bait bait tyr-410 (required) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey physical association physical association Fig 3C. Endogenous tns3 and p130Cas-pY410 form a complex in NSCLC lines that is reduced by PP2. PP2-an inhibitor of the Src family tyrosine kinases Interaction requires phosphorylation of BCAR1 on Tyr-410. bcar1-tens3-4 10 26 unspecified role unspecified role bait bait tyr-410 (required) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey physical association physical association Fig 3C. Endogenous tns3 and p130Cas-pY410 form a complex in NSCLC lines that is reduced by PP2. PP2-an inhibitor of the Src family tyrosine kinases khdr1-tens3-1 1 20 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Fig 3D. Another Src substrate, Sam68 also forms a PP2-sensitive endogenous complex with Tensin-3. PP2-an inhibitor of the Src family tyrosine kinases src-tens3-24 5 18 enzyme enzyme neutral component neutral component n terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 17 enzyme target enzyme target substrate substrate neutral component neutral component sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation Fig 4A.(lanes 5-8 RHS) Pull down of the SH2 3F protein indicated it was not tyrosine phosphorylated and was not associated with Src. Phosphorylation of Tensin 3. Herbimycin A, inhibitor of tyrosine phosphorylation. bcar1-tens3-5 6 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptbdomain sufficient to bind sufficient binding region sufficient to bind range range range range 26 unspecified role unspecified role prey prey tyr-410 (possible) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 4D. Phenylalanine substitution mutations in the SH2 domain affect the binding of some, but not all, endogenous ligands. The GST pull down confirmed that SH2 WT bound to pp130Cas and endogenous integrin-linked kinase (ILK). Y1173 and Y1206 appeared to be more important than Y1256 for p130Cas, FAK, and Src binding. bcar1-tens3-6 12 22 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey tyr-410 (possible) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptbdomain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig 4D. Phenylalanine substitution mutations in the SH2 domain affect the binding of some, but not all, endogenous ligands. The GST pull down confirmed that SH2 WT bound to pp130Cas, FAK and endogenous integrin-linked kinase (ILK). Y1173 and Y1206 appeared to be more important than Y1256 for p130Cas, FAK, and Src binding. bcar1-tens3-8 14 17 unspecified role unspecified role bait bait p-sh2domain phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q68CZ2:p.[Tyr1173Phe;Tyr1206Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:41:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr1173phe,tyr1206phe' Tue Jun 30 19:52:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr1173Phe;Tyr1206Phe]' 26 unspecified role unspecified role prey prey p410 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 5C. p130Cas bound the tyrosine phosphorylated SH2 domains more efficiently than did the nonphosphorylated SH2 domains or the 2F mutant. fak1-tens3-1 9 17 unspecified role unspecified role bait bait p-sh2domain phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. 22 unspecified role unspecified role prey prey tyr-397 (possible) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain human-h358 Homo sapiens Caucasian bronchioalveolar carcinoma h358 Human Caucasian bronchioalveolar carcinoma Also known as NCI-H358. H358 cells secrete a high level of amphiregulin that, in combination with IGF1, prevents serum deprivation apoptosis. physical association physical association Fig 5D. Tyrosine-phosphorylated tensin-3 SH2 domain bound more efficiently to the immobilized endogenous FAK. bcar1-tens3-11 9 26 unspecified role unspecified role prey prey p-y410 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 25 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p-tyr optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig 5E. bcar1-tens3-7 14 26 unspecified role unspecified role prey prey p410 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 25 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p-sh2domain phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 5C. p130Cas bound the tyrosine phosphorylated SH2 domains more efficiently than did the nonphosphorylated SH2 domains. khdr1-tens3-2 14 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p-sh2domain phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptbdomain sufficient to bind sufficient binding region sufficient to bind range range range range 26 unspecified role unspecified role prey prey tyr-410 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain physical association physical association Fig S4A. Binding of Sam68 and p130Cas to the tensin-3 SH2 domain depends on the SH2 tyrosines (Y1173F/Y1206F), unlike the binding of DLC1. p130Cas bound the tyrosine phosphorylated SH2 domains more efficiently than did the nonphosphorylated SH2 domains or the 2F mutant. rhg07-tens3-1 14 17 unspecified role unspecified role bait bait sh2domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p-sh2domain phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptbdomain sufficient to bind sufficient binding region sufficient to bind range range range range 24 unspecified role unspecified role prey prey physical association physical association Fig S4B. Binding of Sam68 and p130Cas to the tensin-3 SH2 domain depends on the SH2 tyrosines, unlike the binding of DLC1. DLC1 added as human,- I think this is referred to as endogenous in the body of paper wrt this figure - though the figure legend implies it might be a construct. (SH2 formed a complex with endogenous integrin-linked kinase (ILK) (Figure 4D) and DLC1 (Figure S4B)) bcar1-tens3-9 4 17 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 3A. Endogenous Tensin-3 in A549 cells partially colocalizes with endogenous vinculin (a marker of focal adhesions), p130Cas, and FAK. tens3-cadh1 10 17 unspecified role unspecified role bait bait region (possible) optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association Fig 2B. Tensin-3 phosphorylation depended upon Src as siRNA-induced knock down of Src in two NSCLC lines, H358 and A549, resulted in almost complete loss of tensin-3 phosphotyrosine. tens3-cadh1-1 3 21 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig 2B. Tensin-3 phosphorylation depended upon Src as siRNA-induced knock down of Src in two NSCLC lines, H358 and A549, resulted in almost complete loss of tensin-3 phosphotyrosine.