IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer. Cell (0092-8674) 2009 imex curation Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang Y., Zhang H., Chen Y., Sun Y., Yang F., Yu W., Liang J., Sun L., Yang X., Shi L., Li R., Li Y., Zhang Y., Li Q., Yi X., Shang Y. Cancer - Interactions investigated in the context of cancer Fast protein liquid chromatography (FPLC) - Superose 6 column. Source of MTA2 taken from references and alignment of identifying peptides. yshang@hsc.pku.edu.cn Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 8 imex curation rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS DIP protein Q16576 original sequence version: 75 DIP protein Q16576 original sequence version: 136 DIP protein Q16576 original sequence version: 97 DIP protein Q16576 original sequence version: 102 DIP protein Q16576 original sequence version: 145 DIP protein Q16576 original sequence version: 116 DIP protein Q16576 original sequence version: 96 1A4B4CD1A8E96815 chd3_human Chromodomain-helicase-DNA-binding protein 3 ATP-dependent helicase CHD3 Mi-2 autoantigen 240 kDa protein Mi2-alpha Zinc finger helicase CHD3 protein protein human Homo sapiens Human MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLLTWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVAAAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDGRKKLRGKKMAPLKIKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRGRPGRKKKKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEWMTVHRIINHSVDKKGNYHYLVKWRDLPYDQSTWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKKKKKELQGDGPPSSPTNDPTVKYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKGGKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAYEGGALIKSSGKLMLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAIARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGRRQSKRQLRNEKDKPLPPLLARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADGSETFADGVPREGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPTTPEASATNSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLAGIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQEPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRIPPIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD DIP protein Q12873 original sequence version: 136 DIP protein Q12873-1 original sequence version: 124 DIP protein Q12873 original sequence version: 156 DIP protein Q12873 original sequence version: 171 DIP protein Q12873 original sequence version: 108 4494F56E5D0E7083 kdm1a_human Lysine-specific histone demethylase 1A Flavin-containing amine oxidase domain-containing protein 2 BRAF35-HDAC complex protein BHC110 KDM1A KIAA0601 LSD1 AOF2 KDM1 [histone H3]-dimethyl-L-lysine(4) FAD-dependent demethylase 1A protein protein human Homo sapiens Human MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPSM A61CEDE51E4E0C1D mbd3_human Methyl-CpG-binding domain protein 3 MBD3 Methyl-CpG-binding protein MBD3 protein protein human Homo sapiens Human MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV DIP protein O95983 original sequence version: 106 B62134DD1BEB636B mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED DIP protein O94776 original sequence version: 128 DIP protein O94776 original sequence version: 122 DIP protein O94776 original sequence version: 85 DIP protein O94776 original sequence version: 120 DIP protein O94776 original sequence version: 130 DIP protein O94776 original sequence version: 146 65087AF798BA64EC mta1_human Metastasis-associated protein MTA1 MTA1 protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED DIP protein Q13330 original sequence version: 146 DIP protein Q13330-1 original sequence version: 127 2D5330F0489AE62E hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA brca2_human Breast cancer type 2 susceptibility protein BRCA2 FANCD1 FACD Fanconi anemia group D1 protein protein protein human Homo sapiens Human MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPNLFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTVKTKMDQADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESLKKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVVDTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEPNDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCDQNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDCILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGLEIHTVCSQKEDSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSYKGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLTSSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCENDPKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLSNLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYMRVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNNLALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVKQHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLSEHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSDCKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKSTFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDCNKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLSDLTFLEVAKAQEACHGNTSNKEQLTATKTEQNIKDFETSDTFFQTASGKNISVAKESFNKIVNFFDQKPEELHNFSLNSELHSDIRKNKMDILSYEETDIVKHKILKESVPVGTGNQLVTFQGQPERDEKIKEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQGTSEITSFSHQWAKTLKYREACKDLELACETIEITAAPKCKEMQNSLNNDKNLVSIETVVPPKLLSDNLCRQTENLKTSKSIFLKVKVHENVEKETAKSPATCYTNQSPYSVIENSALAFYTSCSRKTSVSQTSLLEAKKWLREGIFDGQPERINTADYVGNYLYENNSNSTIAENDKNHLSEKQDTYLSNSSMSNSYSYHSDEVYNDSGYLSKNKLDSGIEPVLKNVEDQKNTSFSKVISNVKDANAYPQTVNEDICVEELVTSSSPCKNKNAAIKLSISNSNNFEVGPPAFRIASGKIVCVSHETIKKVKDIFTDSFSKVIKENNENKSKICQTKIMAGCYEALDDSEDILHNSLDNDECSTHSHKVFADIQSEEILQHNQNMSGLEKVSKISPCDVSLETSDICKCSIGKLHKSVSSANTCGIFSTASGKSVQVSDASLQNARQVFSEIEDSTKQVFSKVLFKSNEHSDQLTREENTAIRTPEHLISQKGFSYNVVNSSAFSGFSTASGKQVSILESSLHKVKGVLEEFDLIRTEHSLHYSPTSRQNVSKILPRVDKRNPEHCVNSEMEKTCSKEFKLSNNLNVEGGSSENNHSIKVSPYLSQFQQDKQQLVLGTKVSLVENIHVLGKEQASPKNVKMEIGKTETFSDVPVKTNIEVCSTYSKDSENYFETEAVEIAKAFMEDDELTDSKLPSHATHSLFTCPENEEMVLSNSRIGKRRGEPLILVGEPSIKRNLLNEFDRIIENQEKSLKASKSTPDGTIKDRRLFMHHVSLEPITCVPFRTTKERQEIQNPNFTAPGQEFLSKSHLYEHLTLEKSSSNLAVSGHPFYQVSATRNEKMRHLITTGRPTKVFVPPFKTKSHFHRVEQCVRNINLEENRQKQNIDGHGSDDSKNKINDNEIHQFNKNNSNQAAAVTFTKCEEEPLDLITSLQNARDIQDMRIKKKQRQRVFPQPGSLYLAKTSTLPRISLKAAVGGQVPSACSHKQLYTYGVSKHCIKINSKNAESFQFHTEDYFGKESLWTGKGIQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISRIWVYNHYRWIIWKLAAMECAFPKEFANRCLSPERVLLQLKYRYDTEIDRSRRSAIKKIMERDDTAAKTLVLCVSDIISLSANISETSSNKTSSADTQKVAIIELTDGWYAVKAQLDPPLLAVLKNGRLTVGQKIILHGAELVGSPDACTPLEAPESLMLKISANSTRPARWYTKLGFFPDPRPFPLPLSSLFSDGGNVGCVDVIIQRAYPIQWMEKTSSGLYIFRNEREEEKEAAKYVEAQQKRLEALFTKIQEEFEEHEENTTKPYLPSRALTRQQVRALQDGAELYEAVKNAADPAYLEGYFSEEQLRALNNHRQMLNDKKQAQIQLEIRKAMESAEQKEQGLSRDVTTVWKLRIVSYSKKEKDSVILSIWRPSSDLYSLLTEGKRYRIYHLATSKSKSKSERANIQLAATKKTQYQQLPVSDEILFQIYQPREPLHFSKFLDPDFQPSCSEVDLIGFVVSVVKKTGLAPFVYLSDECYNLLAIKFWIDLNEDIIKPHMLIAASNLQWRPESKSGLLTLFAGDFSVFSASPKEGHFQETFNKMKNTVENIDILCNEAENKLMHILHANDPKWSTPTKDCTSGPYTAQIIPGTGNKLLMSSPNCEIYYQSPLSLCMAKRKSVSTPVSAQMTSKSCKGEKEIDDQKNCKKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSCGTKYETPIKKKELNSPQMTPFKKFNEISLLESNSIADEELALINTQALLSGSTGEKQFISVSESTRTAPTSSEDYLRLKRRCTTSLIKEQESSQASTEECEKNKQDTITTKKYI DIP protein P51587 original sequence version: 162 DIP protein P51587 original sequence version: 83 DIP protein P51587 original sequence version: 145 DIP protein P51587 original sequence version: 122 DIP protein P51587 original sequence version: 120 DIP protein P51587 original sequence version: 138 DIP protein P51587 original sequence version: 125 DIP protein P51587 original sequence version: 123 DIP protein P51587 original sequence version: 155 DIP protein P51587 original sequence version: 168 DIP protein P51587 original sequence version: 156 DIP protein P51587 original sequence version: 180 6A0B3B7B332153EB mta3_human Metastasis-associated protein MTA3 MTA3 KIAA1266 protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAEYADRHAELSGSPLKSKSTRKPLACIIGYLEIHPAKKPNVIRSTPSLQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDELTCCVSD DIP protein Q9BTC8 original sequence version: 127 E773603F65A16DF1 rcor1_human REST corepressor 1 RCOR1 KIAA0071 RCOR Protein CoREST protein protein human Homo sapiens Human MPAMVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS DIP protein Q9UKL0 original sequence version: 132 DIP protein Q9UKL0 original sequence version: 126 DIP protein Q9UKL0 original sequence version: 115 DIP protein Q9UKL0 original sequence version: 91 DIP protein Q9UKL0 original sequence version: 144 DIP protein Q9UKL0 original sequence version: 80 77E90FB0EFD514B2 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 rbbp4_human Histone-binding protein RBBP4 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 RBBP4 RBAP48 protein protein human Homo sapiens Human MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS DIP protein Q09028 original sequence version: 151 DIP protein Q09028 original sequence version: 111 DIP protein Q09028 original sequence version: 116 DIP protein Q09028-1 original sequence version: 130 DIP protein Q09028 original sequence version: 149 DIP protein Q09028 original sequence version: 159 DIP protein Q09028 original sequence version: 131 B71E2D55A444C360 mta2-brca2-1 4 13 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain association association Mass spectrometric analysis indicate that MTA2 copurified with Mi-2, HDAC1, HDAC2, RbAp46, RbAp48, and MBD3, all of which are components of the NuRD complex, as well as with LSD1 (Figure 1A). In addition, BRCA2 was also detected in the complex. Fig. 1A, Supp. Materials Table 1 mta2-hdac1-2 1 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association The presence of LSD1 in the MTA2/NuRD complex was further confirmed with its antibodies by western blotting analysis (Figure 1B), Fig. 1B RBBP4 and RBBP7 were identified by a single antibody but two bands of different mol. weight were visible. mta2-hdac1-1 6 16 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component association association RBBP4?RBBP7 were identified by a single antibody but two distint bands of different mol. wt. were visible. Fig. 1C mta2-hdac1-3 2 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Fig. 2A Immunoprecipitation (IP) with antibodies against LSD1 followed by immunoblotting (IB) with antibodies against Mi-2, HDAC1, HDAC2, MBD3, MTA1, MTA2, or MTA3 demonstrated that LSD1 coimmunoprecipitated with all of the NuRD components mta2-hdac1-4 5 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Fig. 2B Immunoprecipitation (IP) with antibodies against LSD1 followed by immunoblotting (IB) with antibodies against Mi-2, HDAC1, HDAC2, MBD3, MTA1, MTA2, or MTA3 demonstrated that LSD1 coimmunoprecipitated with all of the NuRD components mta2-hdac1-5 3 15 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Fig. 2B Immunoprecipitation (IP) with antibodies against LSD1 followed by immunoblotting (IB) with antibodies against Mi-2, HDAC1, HDAC2, MBD3, MTA1, MTA2, or MTA3 demonstrated that LSD1 coimmunoprecipitated with all of the NuRD components rcor1-kdm1-1 2 9 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association To determine the relative amount of LSD1 associated with the NuRD complex versus that associated with CoREST in HeLa cells, equal amounts of HeLa cellular extracts were coimmunoprecipitated with antibodies against Mi-2 and CoREST, respectively. Fig. 2C chd3-kdm1-1 2 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association To determine the relative amount of LSD1 associated with the NuRD complex versus that associated with CoREST in HeLa cells, equal amounts of HeLa cellular extracts were coimmunoprecipitated with antibodies against Mi-2 and CoREST, respectively. Fig. 2C