IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. Cancer Cell (1535-6108) 2009 imex curation Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl Accepted 2010-MAR-19 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. Cancer Cell (1535-6108) 2009 imex curation Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl Accepted 2010-MAR-19 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. Cancer Cell (1535-6108) 2009 imex curation Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl Accepted 2010-MAR-19 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome. Cancer Cell (1535-6108) 2009 imex curation Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl 29-Mar-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang S., Laoukili J., Epping MT., Koster J., Holzel M., Westerman BA., Nijkamp W., Hata A., Asgharzadeh S., Seeger RC., Versteeg R., Beijersbergen RL., Bernards R. Cancer - Interactions investigated in the context of cancer Authors supplied details/species of constructs used. r.bernards@nki.nl Accepted 2010-MAR-19 by ORCHARD. 29-Mar-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 rarb_human Retinoic acid receptor beta RARB HAP NR1B2 Nuclear receptor subfamily 1 group B member 2 RAR-epsilon HBV-activated protein protein protein human Homo sapiens Human MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ 8813263AD0495D5A rara_mouse Retinoic acid receptor alpha Rara Nr1b1 Nuclear receptor subfamily 1 group B member 1 protein protein mouse Mus musculus Mouse MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP DIP protein P11416 original sequence version: 140 726F7799633A85AD rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT DIP protein P19793 original sequence version: 177 DIP protein P19793 original sequence version: 107 DIP protein P19793 original sequence version: 153 DIP protein P19793 original sequence version: 131 DIP protein P19793 original sequence version: 136 DIP protein P19793 original sequence version: 169 DIP protein P19793 original sequence version: 161 DIP protein P19793 original sequence version: 139 7F952B580AD84C42 zn423_mouse Zinc finger protein 423 Znf423 Ebfaz Kiaa0760 Nur12 Oaz Zfp423 Olf1/EBF-associated zinc finger protein Smad- and Olf-interacting zinc finger protein Early B-cell factor-associated zinc finger protein protein protein mouse Mus musculus Mouse MSRRKQAKPRSVKVEEGEASDFSLAWDSSVAAAGGLEGEPECDRKTSRALEDRNSVTSQEERNEDDEDVEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTFCSRLFKHKRSRDRHIKLHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCSVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTLHPQLSEKADLQCIHCPEVFVDESTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQSWPKVVYSCPYCSKRDFTSLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKSHAYPVMQFGNISAFHCNYCPEMFADINSLQEHIRVSHCGPNANPPDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSTKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSGSANSISNGEYPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKYNCRFCSKAFHAVILLEKHLREKHCVFDAAAENGTANGVPPTSTKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLVRLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGLRCPECNVKFESAEDLESHMQVDHRDLTPETSGPRKGAQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHAQ 6E0EE26DDCF65E63 zn423_human Zinc finger protein 423 OAZ Olf1/EBF-associated zinc finger protein Smad- and Olf-interacting zinc finger protein ZNF423 KIAA0760 NPHP14 protein protein human Homo sapiens Human MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFNSLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAFHCNYCPEMFADINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNGEYPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENGTANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGLRCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHAQ F34CB87161738321 rarg_human Retinoic acid receptor gamma RARG NR1B3 Nuclear receptor subfamily 1 group B member 3 protein protein human Homo sapiens Human MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA 1EE27B22772D4AFD rxra_mouse Retinoic acid receptor RXR-alpha Rxra Nr2b1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein mouse Mus musculus Mouse MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT 0AF62396BCDC87DB rarbeta_mouse_gene Mouse RARbeta gene gene gene mouse Mus musculus Mouse znf423-rara 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association ZNF423 associated with GST-RXRalpha and GST-RARalpha in both the presence and absence of Retinoic Acid. Fig 4A. znf423-rxra 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association ZNF423 associated with GST-RXRalpha and GST-RARalpha in both the presence and absence of Retinoic Acid. Fig 4A. rara-rxra 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Heterodimerization was observed between GST-RXRalpha and RARalpha or vice versa was observed. Fig 4A. rara-rxra-1 1 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Heterodimerization was observed between GST-RXRalpha and RARalpha or vice versa was observed. Fig 4A. rxra-zn423 3 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig 4B. Endogenous Rxra and Rara comimmunoprecipitated with endogenous Zfp423 indicating that Zfp423 and Rara/Rxra form a stable complex. Consistent with the in vitro binding results, the association of Zfp423 with Rara/Rxra in F9 cells did not require RA but was slightly enhanced when cells were treated with 1 uM RA. rara-zn423 3 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Consistent with the in vitro binding results, the association of Zfp423 with Rara/Rxra in F9 cells did not require RA but was slightly enhanced when cells were treated with 1 uM RA. Fig 4B. Endogenous Rxra and Rara comimmunoprecipitated with endogenous Zfp423 indicating that Zfp423 and Rara/Rxra form a stable complex. I added the Rxra as you asked - and have made it into an "association" - there is now more than one prey. rarb-rxra 2 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait association association Specific enrichment of the of Rar-beta promoter occupancy was observed in Zfp423 and Rxra immunoprecipitates. Fig 4C. rarbeta-zn423 2 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Zfp423 is associated with the RARE region of the Rar-beta promoter. Fig 4C. znf423-rara-1 4 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association Could find no tag location for any tag. We predicted that ZNF423 would also interact with Rar-beta and Rar-gamma in addition to Rar-alpha. Supplementary Material Fig S8A. znf423-rarb 4 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Could find no tag location for any tag. We predicted that ZNF423 would also interact with Rar-beta and Rar-gamma in addition to Rar-alpha. Supplementary Material Fig S8B. znf423-rarg 4 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physical association physical association We predicted that ZNF423 would also interact with Rar-beta and Rar-gamma in addition to Rar-alpha. Supplementary Material Fig S8C.