IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. Nat. Cell Biol. (1465-7392) 2009 imex curation Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. Nat. Cell Biol. (1465-7392) 2009 imex curation Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) Notch-1 was precipitated from SKBr-3 cells. Pin-1, and after blot-restripping, Notch-1, were detected by western blotting. The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. Nat. Cell Biol. (1465-7392) 2009 imex curation Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Accepted 2012-APR-30 by JYOTI Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. Nat. Cell Biol. (1465-7392) 2009 imex curation Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. The prolyl-isomerase Pin1 is a Notch1 target that enhances Notch1 activation in cancer. Nat. Cell Biol. (1465-7392) 2009 imex curation Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rustighi A., Tiberi L., Soldano A., Napoli M., Nuciforo P., Rosato A., Kaplan F., Capobianco A., Pece S., Di Fiore P.P., Del Sal G. Cancer - Interactions investigated in the context of cancer details of pull-down method was found from Shen et al,. Genes Dev 1998, via Reference 14. Fig 4A states "Numbering refers to Swissprot entry P46531." - this does not explain why their protein apparently has 2556 aas rather than 2555 - I assume a mis-print (?) The authors have confirmed that the GST-Pin1, and related contstructs, are Human in origin. delsal@lncib.it Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2009 Only protein-protein interactions imex curation notc1_human Neurogenic locus notch homolog protein 1 Translocation-associated notch protein TAN-1 NOTCH1 TAN1 protein protein human Homo sapiens Human MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK DIP protein P46531 original sequence version: 173 DIP protein P46531 original sequence version: 103 DIP protein P46531 original sequence version: 109 DIP protein P46531 original sequence version: 127 DIP protein P46531 original sequence version: 137 DIP protein P46531 original sequence version: 186 DIP protein P46531 original sequence version: 150 DIP protein P46531 original sequence version: 142 DIP protein P46531 original sequence version: 181 E173C872D195F028 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 hes1_human_gene HES1 HUMAN GENE gene gene human Homo sapiens Human pin1_human_gene PIN1 Human Gene gene gene human Homo sapiens Human pin1-notch1 3 7 unspecified role unspecified role bait bait Q13526:p.Tyr23Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:52:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr23ala' Tue Jun 30 17:30:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr23Ala' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion physical association physical association Fig 1B/S1 lambda phosphatase pin1-notch1-1 3 6 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1B pin1-notch1-2 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey human-mda_mb_468 Homo sapiens MDA-MB-468 mda_mb_468 MDA-MB-468 breast adenocarcinoma Species: human, Black; Tissue: breast; Tumor: adenocarcinoma; Derived from: pleural effusion physical association physical association Fig 1B pin1-notch1-3 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma physical association physical association Fig 1B pin1-notch1-4 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig 1C notch1-pin1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig 1C pin1-notch1-5 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 1731_ha_tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain n1_delta_e binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion physical association physical association Fig 1B The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD). pin1-notch1-6 5 7 unspecified role unspecified role bait bait ww_domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey n1_delta_e binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig 4 A/B The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD). pin1-notch1-7 5 6 unspecified role unspecified role prey prey n1_delta_e_d2171 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P46531:p.[Ser2121Ala;Thr2132Ala;Ser2136Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:04:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser2121ala, thr2132ala, ser2136ala' Wed May 02 18:30:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser2121ala,thr2132ala,ser2136ala' Tue Jun 30 18:40:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser2121Ala;Thr2132Ala;Ser2136Ala]' P46531:p.[Ser2121Ala;Thr2132Ala;Ser2136Ala;Ser2141Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 11:15:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ser2121ala, thr2132ala, ser2136ala, ser2141ala' Wed May 02 16:58:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser2121ala,thr2132ala,ser2136ala,ser2141ala' Tue Jun 30 17:02:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser2121Ala;Thr2132Ala;Ser2136Ala;Ser2141Ala]' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role bait bait ww_domain sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4 D/E The N1deltaE -Flag construct contains the Notch1 signal peptide and the intracellular domain. (deletion of most of the ECD). MAP/SAPK inhibitors. notch1-pin1-1 4 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6D gamma-secretase inhibitor notch1-hes1 4 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association Fig 6D gamma-secretase inhibitor