UniProt UniProt http://www.uniprot.org The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions human-spermatocyte Homo sapiens spermatocyte spermatocyte Spermatocyte confocal microscopy confocal microscopy immunostaining immunostaining Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions human-seminoma Homo sapiens seminoma seminoma testicular germ cell tumor BTO:0000279 is for "testicular cancer cell" - not sufficiently specific. DOID:4440 is for Seminoma - but cannot enter this. confocal microscopy confocal microscopy immunostaining immunostaining Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein. Int. J. Cancer (0020-7136) 2008 imex curation Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer chris.lau@ucsf.edu 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kido T., Lau YF. Cancer - Interactions investigated in the context of cancer COS-7 cells habe been transfected with TSPY1 and FLAG-tagged eEF1A1 or TSPY1 fragment expression vectors. chris.lau@ucsf.edu Accepted 2008-OCT-24 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. gonadal cDNA library of E11.5 mouse embryos Int. J. Cancer (0020-7136) 2008 orchard Only protein-protein interactions imex curation set_human Protein SET Phosphatase 2A inhibitor I2PP2A Template-activating factor I HLA-DR-associated protein II PHAPII Inhibitor of granzyme A-activated DNase SET protein protein human Homo sapiens Human MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD F4664118171EF230 ef1a2_mouse Elongation factor 1-alpha 2 Eukaryotic elongation factor 1 A-2 Statin-S1 Eef1a2 Eef1al Stn protein protein mouse Mus musculus Mouse MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK 31E4F59BC05D8F8C tspy1_human Testis-specific Y-encoded protein 1 TSPY1 TSPY Cancer/testis antigen 78 protein protein human Homo sapiens Human MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS DIP protein Q01534 original sequence version: 109 5BDF0770F0B400A2 ef1a1_mouse Elongation factor 1-alpha 1 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Eef1a1 Eef1a protein protein mouse Mus musculus Mouse MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGSASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK DIP protein P10126 original sequence version: 149 71072871DE7405DC tspy1_rat Testis-specific Y-encoded protein 1 Tspy1 Tspy protein protein rat Rattus norvegicus (Rat) Rat MENSEEESVGVAPQEFRELVLLESSLLEGEPSVQAPEQSPGAPAGDNQMVKPLVICGPVEDWVPLAEVLHHPDTCEEGDEATMAELKVTEVVDVKNEGEEVKDQKQEGEQDQQPELEKNPEQACDSKDQQGIQRLPLSGGGPAERRSKMEELELLQLELSFVNARCSGAFARIKAKVAKMRRPHFDRRKTIIQGIPGFWAKAMMNHPQMSSIISNQDEDLLSYMLSLEVEEYNPGLRMCRMMFFFSENPYFRNDIVTKDYQLSIIGYKESDSSTIEWIGQAEHGYANCMQDTTRLTFFNWLCAHKFPGSNRIAEIIMDDLWPNPLYYYPKEDHS 2A49DD2AB52D924D ef1a1_human Elongation factor 1-alpha 1 EEF1A1 EEF1A EF1A LENG7 Eukaryotic elongation factor 1 A-1 Elongation factor Tu Leukocyte receptor cluster member 7 protein protein human Homo sapiens Human MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK DIP protein P68104 original sequence version: null DIP protein P68104 original sequence version: 134 D465615545AF686A tsyl2_human Testis-specific Y-encoded-like protein 2 TSPYL2 Differentially-expressed nucleolar TGF-beta1 target protein Cell division autoantigen 1 Cutaneous T-cell lymphoma-associated antigen se20-4 Nuclear protein of 79 kDa CDA1 DENTT TSPX HRIHFB2216 protein protein human Homo sapiens Human MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQEETEAAQVLADMRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDSTIESGYGEAPPPTESLEALPTPEASGGSLEIDFQVVQSSSFGGEGALETCSAVGWAPQRLVDPKSKEEAIIIVEDEDEDERESMRSSRRRRRRRRRKQRKVKRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRLKRKFIQMRRPFLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG 726F3BDC10A36165 tspy1-eef1a1 1 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain 19 17 physical association physical association no figure tspy1-eef1a1-1 2 12 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 24 22 physical association physical association 1B tspy1-eef1a1-2 6 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-2009827]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 463-463, sequence length 462 [EBI-2009827]305-463 in vitro In vitro association association 2b and c The results showed that eEF1A2[305-463] is capable of binding to TSPY tspyl2-eef1a1-1 6 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 35 39 association association 2c GST pulldown was performed as in (b) with the indicated GST-fusion proteins and 35S-labeledeEF1A1[305-462] set-eef1a1-4 6 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 43 46 association association 2c GST-SET[74-223] (Fig. 2c, Lane 7) bound readily with eEF1A1[305-462]. tspy1-eef1a2 6 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro association association 2c tspy1-eef1a2-1 3 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization 3b To confirm the interaction between TSPY and eEF1A in mammalian cells, immunofluorescence was performed on COS7 cells transfected with TSPY and FLAG-eEF1A1 or eEF1A2-V5 expression vectors. tspy1-eef1a1-3 3 10 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization 3a To confirm the interaction between TSPY and eEF1A in mammalian cells, immunofluorescence was performed on COS7 cells transfected with TSPY and FLAG-eEF1A1 or eEF1A2-V5 expression vectors. tspy1-eef1a1-4 4 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 4 eef1a1-tspy1 7 10 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association 3c Co-immunoprecipitation assay for the interaction between TSPY and FLAG-eEF1A1. P10126 transfection tspy1-tspy1 7 10 unspecified role unspecified role prey prey chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 association association 3d Q01534 transfection The dimerization of TSPY was analyzed by co-immunoprecipitation assay, using FLAG-TSPY[76-150]. tspy1-eef1a1-5 5 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 tspy1-eef1a1-6 2 10 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 82 80 physical association physical association 1B Our results showed that only the human TSPY[151-308] and rat Tspy[185-334] interacted with eEF1A1 [305-462] in yeast (Fig. 1b). tspy1-eef1a1-7 3 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 13 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 colocalization colocalization 7 Immunofluorescence analysis showed that FLAG-NLS-TSPY was indeed preferentially localized in the nuclei of transfected COS7 cells, while FLAG-TSPY was distributed in both nuclei and cytoplasm similarly with non-tagged TSPY