IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Induction of EMT by twist proteins as a collateral effect of tumor-promoting inactivation of premature senescence. Induction of EMT by twist proteins as a collateral effect of tumor-promoting inactivation of premature senescence. Cancer Cell (1535-6108) 2008 imex curation Ansieau S., Bastid J., Doreau A., Morel AP., Bouchet BP., Thomas C., Fauvet F., Puisieux I., Doglioni C., Piccinin S., Maestro R., Voeltzel T., Selmi A., Valsesia-Wittmann S., Caron de Fromentel C., Puisieux A. Cancer - Interactions investigated in the context of cancer puisieux@lyon.fnclcc.fr 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ansieau S., Bastid J., Doreau A., Morel AP., Bouchet BP., Thomas C., Fauvet F., Puisieux I., Doglioni C., Piccinin S., Maestro R., Voeltzel T., Selmi A., Valsesia-Wittmann S., Caron de Fromentel C., Puisieux A. Cancer - Interactions investigated in the context of cancer puisieux@lyon.fnclcc.fr Accepted 2008-SEP-4 by DAVET. 27-Aug-2008: Contacted by JYOTI. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 4 imex curation Induction of EMT by twist proteins as a collateral effect of tumor-promoting inactivation of premature senescence. Induction of EMT by twist proteins as a collateral effect of tumor-promoting inactivation of premature senescence. Cancer Cell (1535-6108) 2008 imex curation Ansieau S., Bastid J., Doreau A., Morel AP., Bouchet BP., Thomas C., Fauvet F., Puisieux I., Doglioni C., Piccinin S., Maestro R., Voeltzel T., Selmi A., Valsesia-Wittmann S., Caron de Fromentel C., Puisieux A. Cancer - Interactions investigated in the context of cancer puisieux@lyon.fnclcc.fr 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ansieau S., Bastid J., Doreau A., Morel AP., Bouchet BP., Thomas C., Fauvet F., Puisieux I., Doglioni C., Piccinin S., Maestro R., Voeltzel T., Selmi A., Valsesia-Wittmann S., Caron de Fromentel C., Puisieux A. Cancer - Interactions investigated in the context of cancer puisieux@lyon.fnclcc.fr Accepted 2008-SEP-4 by DAVET. Cancer Cell (1535-6108) 2008 davet Only protein-protein interactions 4 imex curation twst2_human Twist-related protein 2 Dermis-expressed protein 1 TWIST2 DERMO1 BHLHA39 Class A basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH 8F44750916940C0A twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH DIP protein Q15672 original sequence version: 156 DIP protein Q15672 original sequence version: 159 9394E4351BA1D081 ets2_human Protein C-ets-2 ETS2 protein protein human Homo sapiens Human MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQSSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED DIP protein P15036 original sequence version: 158 5944EC4B5AAB553E twist1-ets2 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Q15672; P15036 transfection S3 A preliminary experiments suggest that the ability of Twist proteins to prevent the Ras-mediated activation of p16INK4A might be associated with their ability to interact with the Ras effector Ets2 twist2-ets2 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Q8WVJ9; P15036 transfection S3 A preliminary experiments suggest that the ability of Twist proteins to prevent the Ras-mediated activation of p16INK4A might be associated with their ability to interact with the Ras effector Ets2 ets2-twist2 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Q8WVJ9; P15036 transfection S3 B preliminary experiments suggest that the ability of Twist proteins to prevent the Ras-mediated activation of p16INK4A might be associated with their ability to interact with the Ras effector Ets2 ets2-twist1 1 4 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait physical association physical association Q15672; P15036 transfection S3 B preliminary experiments suggest that the ability of Twist proteins to prevent the Ras-mediated activation of p16INK4A might be associated with their ability to interact with the Ras effector Ets2