IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A protein-protein interaction network of transcription factors acting during liver cell proliferation. A protein-protein interaction network of transcription factors acting during liver cell proliferation. Genomics (0888-7543) 2008 imex curation Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn 16-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Accepted 2008-APR-20 by ORCHARD. 16-April-2008: Contacted by JYOTI. Genomics (0888-7543) 2008 orchard Only protein-protein interactions imex curation A protein-protein interaction network of transcription factors acting during liver cell proliferation. A protein-protein interaction network of transcription factors acting during liver cell proliferation. Genomics (0888-7543) 2008 imex curation Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn 16-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Accepted 2008-APR-20 by ORCHARD. 16-April-2008: Contacted by JYOTI. Genomics (0888-7543) 2008 orchard Only protein-protein interactions imex curation A protein-protein interaction network of transcription factors acting during liver cell proliferation. A protein-protein interaction network of transcription factors acting during liver cell proliferation. Genomics (0888-7543) 2008 imex curation Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn 16-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Accepted 2008-APR-20 by ORCHARD. Genomics (0888-7543) 2008 orchard Only protein-protein interactions imex curation phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK A887CC982BF85C80 atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 DIP protein P18848 original sequence version: 181 DIP protein P18848 original sequence version: 117 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. 3BBB7379DC3B0D07 cnot3_human CCR4-NOT transcription complex subunit 3 CCR4-associated factor 3 Leukocyte receptor cluster member 2 CNOT3 KIAA0691 NOT3 LENG2 protein protein human Homo sapiens Human MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ DIP protein O75175 original sequence version: 92 C9D4F8B9FEF6CD90 zn331_human Zinc finger protein 331 ZNF331 RITA ZNF463 ZNF361 Zinc finger protein 361 Zinc finger protein 463 C2H2-like zinc finger protein rearranged in thyroid adenomas protein protein human Homo sapiens Human MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSFSHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS A9DB42D0870A7767 zn626_human Zinc finger protein 626 ZNF626 protein protein human Homo sapiens Human MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGITVSKPDLITCLEQGRKPLTMKRNEMIAKPSVMCSHFAQDLWPEQSMKDSFQKVVLRRYEKCEHDNLQLKKGCISVDECKVHKEGYNELNQCLTTTPRKICQCDKYVKVLHQFPNSNGQKRGHTGKKPFKYIECGKAFKQFSTLTTHKKIHTGGKPYKCEECGKAFNHSCSLTRHKKIHTGEKPYKCEECGKAFKHSSTLTTHKRNHTGEKPYKCDKCGKAFMSSSTLSKHEIIHTEKKPYKCEECGKAFNRSSTLTTHKIIHTGEKPYKCEECDKAFKYSYTLTTHKRIHTEDKPYKCEECGKAFKYSSTLTTHKRIHTGEKPYKCEECGKAFKRSSDLTTHKIIHTGEKPYKCEECGKAFKYSSNLTTHKKIHTGERPYKCEECGKAFNQSSILTTHRRIHTGEKFYKCEECGKAFKCSSNLTTHKKIHTGERPYKCEECGKAFNQSSILTTHERIILERNSTNVKNVAKPSSGPHTLLHIR 4F631D271B872653 gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ BC283A445E50A652 requ_human Zinc finger protein ubi-d4 DPF2 REQ UBID4 Protein requiem Apoptosis response zinc finger protein D4, zinc and double PHD fingers family 2 BAF45D BRG1-associated factor 45D protein protein human Homo sapiens Human MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS 1044B4D3036075FC tp4a1_human Protein tyrosine phosphatase type IVA 1 PTP4A1 PRL1 PTPCAAX1 PTP(CAAXI) Protein-tyrosine phosphatase 4a1 Protein-tyrosine phosphatase of regenerating liver 1 protein protein human Homo sapiens Human MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ 702008013D3F3835 dus6_human Dual specificity protein phosphatase 6 Mitogen-activated protein kinase phosphatase 3 Dual specificity protein phosphatase PYST1 DUSP6 MKP3 PYST1 protein protein human Homo sapiens Human MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST 386612227F5D3B2A stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 rnd1_human Rho-related GTP-binding protein Rho6 RND1 RHO6 Rho family GTPase 1 Rnd1 protein protein human Homo sapiens Human MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM DIP protein Q92730 original sequence version: 146 9FD56ACB878FBCCA mlx_human Max-like protein X Max-like bHLHZip protein BHLHD13 Protein BigMax Transcription factor-like protein 4 MLX TCFL4 Class D basic helix-loop-helix protein 13 protein protein human Homo sapiens Human MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY D1981730051473C5 fhl2_human Four and a half LIM domains protein 2 Skeletal muscle LIM-protein 3 LIM domain protein DRAL FHL2 DRAL SLIM3 protein protein human Homo sapiens Human MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI DIP protein Q14192 original sequence version: null DIP protein Q14192 original sequence version: 142 DIP protein Q14192 original sequence version: 136 E94E3A7F6601F9F3 id3_human DNA-binding protein inhibitor ID-3 ID3 1R21 BHLHB25 Inhibitor of DNA binding 3 ID-like protein inhibitor HLH 1R21 Helix-loop-helix protein HEIR-1 HEIR1 Class B basic helix-loop-helix protein 25 Inhibitor of differentiation 3 protein protein human Homo sapiens Human MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH DIP protein Q02535 original sequence version: 143 7FC38B56B4DCEFBC csk_human Tyrosine-protein kinase CSK CSK C-Src kinase Protein-tyrosine kinase CYL protein protein human Homo sapiens Human MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELHL 431023A88C54E00C s30bp_human SAP30-binding protein Transcriptional regulator protein HCNGP SAP30BP HTRG HCNGP HTRP protein protein human Homo sapiens Human MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ C48CEFBD73CE82BC znf3_human Zinc finger protein 3 ZNF3 KOX25 Zinc finger protein KOX25 Zinc finger protein HF.12 Zinc finger protein HZF3.1 protein protein human Homo sapiens Human METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELNIREST EEF50906695779A6 cr3l2_human Cyclic AMP-responsive element-binding protein 3-like protein 2 CREB3L2 BBF2H7 BBF2 human homolog on chromosome 7 protein protein human Homo sapiens Human MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYTASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF 64699072EEB454D3 ikzf4_human Zinc finger protein Eos IKZF4 KIAA1782 ZNFN1A4 Ikaros family zinc finger protein 4 protein protein human Homo sapiens Human MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQPPPTIVVGRHSPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFLDHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG 42AE169A3E2E14D3 hbp1_human HMG box-containing protein 1 HMG box transcription factor 1 High mobility group box transcription factor 1 HBP1 protein protein human Homo sapiens Human MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH 2AFADC995F73A031 q6fhm2_human GNB2 hCG_20449 protein protein human Homo sapiens Human MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN 5D08FFA240ADEEE6 pi42c_human Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma PIP4K2C PIP5K2C Phosphatidylinositol 5-phosphate 4-kinase type II gamma protein protein human Homo sapiens Human MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIFA 65D1CBCF0826D476 atf3_human Cyclic AMP-dependent transcription factor ATF-3 Activating transcription factor 3 ATF3 protein protein human Homo sapiens Human MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS DIP protein P18847 original sequence version: 107 EC5D8F065EEE2D9C puf60_human Poly(U)-binding-splicing factor PUF60 60 kDa poly(U)-binding-splicing factor FUSE-binding protein-interacting repressor Siah-binding protein 1 Ro-binding protein 1 PUF60 SIAHBP1 FIR ROBPI protein protein human Homo sapiens Human MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA 619F3C30D1C5951C zn408_human Zinc finger protein 408 ZNF408 PFM14 PRDM17 PR domain zinc finger protein 17 protein protein human Homo sapiens Human MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRDILALKSLPRGLALGPSLAKEQRLGVWCVGDPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDVCACEQSSGWTSLVQRGRLESEGNVAPVRISERLHLQVYQLVLPGSELLLWPQPSSEGPSLTQPGLDKEAAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFPTQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQPHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGKAFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYGTQRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQGSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELRRHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLDTHREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT 0D3CDA7572D17721 nkx23_human Homeobox protein Nkx-2.3 NKX2-3 NKX23 NKX2C Homeobox protein NK-2 homolog C protein protein human Homo sapiens Human MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGGGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQGIRAW 10A279CFA3C8A6DB zn212_human Zinc finger protein 212 ZNF212 ZNFC150 Zinc finger protein C2H2-150 protein protein human Homo sapiens Human MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL AF0F7EEC8A482F8A gnl1_human Guanine nucleotide-binding protein-like 1 GNL1 HSR1 GTP-binding protein HSR1 protein protein human Homo sapiens Human MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHIRRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYALLGEDEC F8EBB4EDBB73D929 atf3-atf3 3 27 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_001030287 atf3-fhl2 3 17 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_001450 atf3-id3 3 18 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_002167 atf4-znf212 3 5 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_001675; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. cnot3-id3 3 18 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_014516; PREY gene NM_002167 The ORF of CNOT3 used in this study encoded a truncated protein product missing the C-terminal end. csk-id3 3 19 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_004383; PREY gene NM_002167 The ORF of CSK used in this study encoded a truncated protein product missing the C-terminal end. dpf2-fhl2 3 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_006268; PREY gene NM_001450 fhl2-atf3 3 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_001030287 fhl2-csk 3 19 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_004383 The ORF of CSK used in this study encoded a truncated protein product missing the C-terminal end. fhl2-dpf2 3 17 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_006268 fhl2-sap30bp 3 20 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_013260 fhl2-id3 3 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_002167 fhl2-puf60 3 28 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_014281 fhl2-stat3 3 17 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_003150 fhl2-znf331 3 7 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_018555 fhl2-znf408 3 17 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. fhl2-znf626 3 8 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_145297 The ORF of ZNF626 used in this study encoded a truncated protein product missing the C-terminal end. fhl2-znfn1a4 3 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_022465 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. gnb2-id3 3 25 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_005273; PREY gene NM_002167 gnl1-gdi1 3 32 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_005275; PREY gene NM_001493 gnl1-ptp4a1 3 32 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_005275; PREY gene NM_003463 sap30bp-puf60 3 20 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_013260; PREY gene NM_014281 fhl2-flh2 3 17 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_001450 id3-id3 3 18 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_002167; PREY gene NM_002167 nfkbia-atf4 3 14 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_020529; PREY gene NM_001675 pip4k2c-pip4k2c 3 26 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_024779; PREY gene NM_024779 ptp4a1-creb3l2 3 22 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_003463; PREY gene NM_194071 phb2-fhl2 3 17 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_007273; PREY gene NM_001450 rnd1-creb3l2 3 15 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_014470; PREY gene NM_194071 rnd1-id3 3 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_014470; PREY gene NM_002167 puf60-sap30bp 3 28 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_014281; PREY gene NM_013260 puf60-id3 3 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_014281; PREY gene NM_002167 mlx-sap30bp 3 20 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_198205; PREY gene NM_013260 mlx-id3 3 16 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_198205; PREY gene NM_002167 znf212-atf3 3 31 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001030287 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-creb3l2 3 22 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_194071 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-csk 3 19 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_004383 The ORFs of ZNF212 and CSK used in this study encoded truncated protein products missing the C-terminal end. znf212-dpf2 3 10 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_006268 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-dusp6 3 12 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001946 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-fhl2 3 17 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001450 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-gnl1 3 31 unspecified role unspecified role bait bait 32 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_005275 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-hbp1 3 24 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_012257 The ORFs of HBP1 and ZNF212 used in this study encoded truncated protein products missing the C-terminal end. znf212-sap30bp 3 20 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_013260 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-nfkbia 3 31 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_020529 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-ptp4a1 3 11 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_003463 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-nkx2_3 3 31 unspecified role unspecified role bait bait 30 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_145285 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-rnd1 3 15 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_014470 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-znf212 3 31 unspecified role unspecified role bait bait 31 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-znf3 3 31 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_032924 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-znf331 3 7 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_018555 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf212-znf408 3 31 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_024741 The ORFs of ZNF408 and ZNF212 used in this study encoded truncated protein products missing the C-terminal end. znf3-fhl2 3 21 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_001450 znf3-id3 3 18 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_002167 znf3-znf212 3 31 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. znf3-znf3 3 21 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_032924 znf331-fhl2 3 7 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_018555; PREY gene NM_001450 znf408-fhl2 3 29 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_001450 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. znf408-sap30bp 3 20 unspecified role unspecified role prey prey 29 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score I Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_013260 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. znf331-znf408 3 29 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_018555; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. znf408-id3 3 29 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_002167 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. znf408-znf408-3 3 29 unspecified role unspecified role bait bait 29 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score IV Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. znf626-id3 3 18 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score II Fig. 1, Table 1 BAIT gene NM_145297; PREY gene NM_002167 The ORF of ZNF626 used in this study encoded a truncated protein product missing the C-terminal end. znfn1a4-fhl2 3 17 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_022465; PREY gene NM_001450 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. znfn1a4-nfkbia 3 14 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score III Fig. 1, Table 1 BAIT gene NM_022465; PREY gene NM_020529 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. pip4k2c-pip4k2c-1 2 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_024779; PREY gene NM_024779 znf3-znf3-1 2 21 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_032924; PREY gene NM_032924 znf3-znf212-1 2 31 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_032924; PREY gene NM_012256 atf3-atf3-1 2 27 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 27 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_001030287; PREY gene NM_001030287 znf212-znf3-1 2 21 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 31 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_012256; PREY gene NM_032924 znf408-znf408-4 2 29 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 29 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_024741; PREY gene NM_024741 znf212-znf3-2 2 31 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 31 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 BAIT gene NM_012256; PREY gene NM_012256 fhl2-znf408-1 1 17 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 29 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3 BAIT gene NM_001450; PREY gene NM_024741 fhl2-atf3-1 1 27 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3 BAIT gene NM_001450; PREY gene NM_001030287 fhl2-flh2-1 1 17 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3 BAIT gene NM_001450; PREY gene NM_001450 sap30bp-puf60-1 1 28 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3 BAIT gene NM_013260; PREY gene NM_014281