IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. Cancer Res. (0008-5472) 2007 Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer young-mee.park@roswellpark.org DAVET in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer Reference 22 (PMID 16707435) refers to the PMID 8643607 as reference 36, which specifies that the androgen construct is of human origin. young-mee.park@roswellpark.org Accepted 2007-DEC-23 by DAVET. Cancer Res. (0008-5472) 2007 DAVET Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. Peroxiredoxin 1 interacts with androgen receptor and enhances its transactivation. Cancer Res. (0008-5472) 2007 Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer young-mee.park@roswellpark.org DAVET human-ln3 Homo sapiens androgen-sensitive and highly metastatic human prostate cancer cell line LN3 ln3 Human androgen-sensitive and highly metastatic human prostate cancer cell line LN3 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park SY., Yu X., Ip C., Mohler JL., Bogner PN., Park YM. Cancer - Interactions investigated in the context of cancer young-mee.park@roswellpark.org Accepted 2007-DEC-23 by DAVET. Cancer Res. (0008-5472) 2007 DAVET andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 prdx1_human Peroxiredoxin-1 PRDX1 PAGA PAGB TDPX2 Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 Proliferation-associated gene protein Natural killer cell-enhancing factor A Thioredoxin-dependent peroxiredoxin 1 protein protein human Homo sapiens Human MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK DIP protein Q06830 original sequence version: 144 DIP protein Q06830 original sequence version: 180 8F68E56D75BF5304 prdx1-ar 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 6 A AR was coprecipitated with Prx1 after hypoxia/reoxygenation when a Prx1 antibody was used for immunoprecipitation. Hypoxia/reoxygenation - This interaction was enhanced when LN3 cells were treated with 4 h hypoxia/2 h reoxygenation. ar-prdx1 2 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 6 A Hypoxia/reoxygenation - This interaction was enhanced when LN3 cells were treated with 4 h hypoxia/2 h reoxygenation. Prx1 was coprecipitated with AR after hypoxia/reoxygenation when an AR antibody was used for immunoprecipitation prdx1-ar-1 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction we carried out pull-down experiments using purified Prx1 and in vitro-translated AR. The cell-free experiments showed a direct interaction between Prx1 and AR 6 C In pull-down assays using Prx1 C52S or in vitro oxidized Prx1, similar interactions between AR and these Prx1 proteins lacking antioxidant activity were observed.