IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors confocal microscopy confocal microscopy immunostaining immunostaining Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. E-Cadherin Is Required for Caveolin-1-Mediated Down-Regulation of the Inhibitor of Apoptosis Protein Survivin via Reduced {beta}-Catenin-Tcf/Lef-Dependent Transcription. Mol. Cell. Biol. (0270-7306) 2007 imex curation Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin davet Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line confocal microscopy confocal microscopy immunostaining immunostaining Torres VA., Tapia JC., Rodriguez DA., Lladser A., Arredondo C., Leyton L., Quest AF. Cancer - Interactions investigated in the context of cancer The colocalization was shown in HT-29(ATCC) cells not HT-29(US) cells (derived from a metastasis). aquest@med.uchile.cl aquest@med.uchile.cl. Accepted 2007-DEC-8 by DAVET. 22-Jan-2008: Contacted by JYOTI. Antibodies used were polyclonal anti-caveolin-1, monoclonal anti-beta-catenin Mol. Cell. Biol. (0270-7306) 2007 davet Only protein-protein interactions imex curation ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E cadh1_human Cadherin-1 Epithelial cadherin Uvomorulin CAM 120/80 CDH1 CDHE UVO protein protein human Homo sapiens Human MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVGHHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTGAISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P12830 original sequence version: 191 DIP protein P12830 original sequence version: 185 DIP protein P12830 original sequence version: 108 DIP protein P12830 original sequence version: null DIP protein P12830 original sequence version: 134 DIP protein P12830 original sequence version: 147 DIP protein P12830 original sequence version: 174 DIP protein P12830 original sequence version: 189 DIP protein P12830 original sequence version: 156 DIP protein P12830 original sequence version: 201 DIP protein P12830 original sequence version: 117 E427118043A13C67 ctnb1_canlf Catenin beta-1 CTNNB1 Beta-catenin protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTTQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL 6148652F953F0723 q95le0_canlf protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MGPRYGGAPALLLPLLLLLQVSSGLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGCTGLPRTAYVSDDTRFKVGTDGVITVKRPLQLHKPEISFLVHAWDSSRRKLSTRVRLKAATHHHHHHHDAPSKTQTEVLTFPSSQHGLRRQKRDWVIPPISCPENEKGPFP EA40F4775B59B0FD cav1_canlf Caveolin-1 CAV1 CAV Vesicular integral-membrane protein VIP21 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPFFEAVGKIFSNIRINMQKET DD77CE4D436E508D cadh1_mouse Cadherin-1 Epithelial cadherin Uvomorulin ARC-1 Cdh1 protein protein mouse Mus musculus Mouse MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P09803 original sequence version: 92 DIP protein P09803 original sequence version: 116 DIP protein P09803 original sequence version: 124 DIP protein P09803 original sequence version: 128 DIP protein P09803 original sequence version: 141 DIP protein P09803 original sequence version: 174 7A6444148D3D5983 cav1-ctnnb1 2 7 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association 3 A colocalization between caveolin-1 and catenin was evident in HT29(ATCC) but not in HT29(US) cells This colocalization took place in HT-29(ATCC) cells but nor HT-29(US) (derived from a metastasis) cells. P33724 transfection The colocalization took place at or near the plasma membrane. cav1-ctnnb1-1 6 9 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association 3 A The colocalization took place at or near the plasma membrane. ectopically expressed caveolin-1 accumulated near the cell surface in a manner similar to that of -catenin, and an appreciable degree of colocalization was apparent in cells expressing high levels of caveolin-1, as was also the case for MDCK cells cav1-cdh1 3 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 6 A Readily detectable amounts of -catenin coimmunoprecipitated with caveolin-1 from transfected HEK293T, DLD1, and HT29(ATCC) cells, as well as MDCK cells E-cadherin was also readily detectable in caveolin-1 immunoprecipitates obtained from HEK293T, MDCK, DLD1, and HT29(ATCC) cells but not those from HT29(US) cells P33724 transfection cav1-ctnnb1-2 5 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait gtpase reaction gtpase reaction 6A, 9 P33724 transfection -catenin coimmunoprecipitated only poorly with caveolin-1 from HT29(US) cells ectopically expressing the protein Beta-catenin coimmunoprecipitated only poorly with caveolin-1 from HT29(US) cells ectopically expressing the protein and did not coimmunoprecipitate E-cadherin. E-cadherin promoted the association of caveolin-1 with beta-catenin cav1-ctnnb1-3 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait gtpase reaction gtpase reaction 6 A P33724 transfection Readily detectable amounts of -catenin coimmunoprecipitated with caveolin-1 from transfected HEK293T, DLD1, and HT29(ATCC) cells, as well as MDCK cells cav1-cdh1-1 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 6 A Readily detectable amounts of -catenin coimmunoprecipitated with caveolin-1 from transfected HEK293T, DLD1, and HT29(ATCC) cells, as well as MDCK cells E-cadherin was also readily detectable in caveolin-1 immunoprecipitates obtained from HEK293T, MDCK, DLD1, and HT29(ATCC) cells but not those from HT29(US) cells cav1-cdh1-2 3 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 7 A P33724; P09803 transfection Transiently expressed caveolin-1 was immunoprecipitated from cells either cotransfected with pBATEM2 for E-cadherin expression or not. In HEK293T cells with augmented E-cadherin levels, coimmunoprecipitation of E-cadherin and -catenin with caveolin-1 increased