IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-dld1 Human colorectal adenocarcinoma dld1 Human colon adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Ku70 and poly(ADP-ribose) polymerase-1 competitively regulate beta-catenin and T-cell factor-4-mediated gene transactivation: possible linkage of DNA damage recognition and Wnt signaling. Cancer Res. (0008-5472) 2007 imex curation Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp 12-MAR-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Idogawa M., Masutani M., Shitashige M., Honda K., Tokino T., Shinomura Y., Imai K., Hirohashi S., Yamada T. Cancer - Interactions investigated in the context of cancer Nuclear extract of HCT116 cells was immunoprcipitated with anti-TCF-4 antibody and subject to western blotting. tyamada@gan2.res.ncc.go.jp Accepted 2007-APR-1 by JYOTI. 12-MAR-2007: Contacted by JYOTI. Cancer Res. (0008-5472) 2007 Only protein-protein interactions imex curation parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI DIP protein P13010 original sequence version: 128 DIP protein P13010 original sequence version: 127 DIP protein P13010 original sequence version: 122 DIP protein P13010 original sequence version: 174 DIP protein P13010 original sequence version: 153 DIP protein P13010 original sequence version: 155 DIP protein P13010 original sequence version: 142 2363CA84834E74A3 xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB tf7l2_human Transcription factor 7-like 2 TCF7L2 TCF4 HMG box transcription factor 4 T-cell-specific transcription factor 4 protein protein human Homo sapiens Human MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE DIP protein Q9NQB0 original sequence version: 101 DIP protein Q9NQB0 original sequence version: 99 DIP protein Q9NQB0 original sequence version: 116 4DD2D3CC814AE16E ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E tcf7l2-parp1 7 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association We previously identified one of these proteins as PARP-1 (Fig. 1A). Proteins of f70 kDa (Fig. 1A, b) and 86 kDa (Fig. 1A, a) were also constantly coimmunoprecipitated with FLAG-tagged TCF-4 and were subjected to protein identification by mass spectrometry. Peptide mass fingerprinting and tandem mass spectrometry (data not shown) revealed that these proteins were Ku70 (70-kDa thyroid autoantigen/thyroid-lupus autoantigen/G22P1) and Ku80 (X-ray repair, complementing defective, in Chinese hamster, 5/XRCC5). 1 A Q9NQB0 transfection tcf7l2-parp1-1 2 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1 B The protein identification was confirmed by Western blotting with anti-Ku70 and anti-Ku80 antibodies. Ku70, Ku80, and PARP-1 proteins were detected in the immunoprecipitate with anti-FLAG antibody Q9NQB0 transfection parp1-tcf7l2-1 1 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 1 C Ku70, Ku80, and FLAG-tagged TCF-4 proteins were detected in the immunoprecipitate with anti-PARP-1 antibody Q9NQB0 transfection g22p1-parp1 1 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association 1 C FLAG-tagged TCF-4 (FLAG), Ku80, and PARP-1 were also detected in the immunoprecipitate with anti-Ku70 antibody Q9NQB0 transfection tcf7l2-ctnnb1-8 4 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 1 D Ku70, Ku80, PARP-1, and beta-catenin proteins were coimmunoprecipitated with endogenous TCF-4 from a lysate of colorectal cancer HCT116 cells parp1-g22p1 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association S1 Ku70 and Ku80 were also coimmunoprecipitated with PARP-1 tcf7l2-g22p1 2 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A Q9NQB0 transfection To identify the region of TCF-4 that is essential for its interaction with Ku70, we expressed serially truncated forms of FLAG-TCF-4 and evaluated their binding activity to Ku70 (Fig. 2A). Only constructs carrying the high-mobility group (HMG) box [wild-type (WT), DC439, and DN316] were found to bind to Ku70 g22p1-tcf7l2 5 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2 B Q9NQB0; P12956 transfection Only the full-length Ku70 protein (WT) and the Ku70 protein lacking the SAP domain (DC560) interacted with TCF-4 tcf7l2-g22p1-1 6 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Q9NQB0 transfection 4 A, B Ku70 was coimmunoprecipitated with FLAG-TCF-4 even in the absence of PARP-1 (Fig. 4A), revealing that PARP-1 is not necessary for the interaction between TCF-4 and Ku. Restoration of PARP-1 did not affect the total amount of Ku70 in the nucleus (Fig. 4B, Total), but the amount of Ku70 coimmunoprecipitated with FLAG-TCF-4 was reduced (Fig. 4B, IP: FLAG), suggesting that PARP-1 competes with Ku70 for binding to TCF-4. The amount of Ku70 coimmunoprecipitated with FLAG-TCF-4 was reduced by the presence of PARP1. The results indicate PARP1 and Ku70 compete for binding to TCF-4. tcf7l2-ctnnb1-7 2 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Q9NQB0; P35222 transfection 4 D Ku70 seems to suppress the transcriptional activity of TCF-4 by inhibiting the participation of beta-catenin in the transcriptional complex containing TCF-4. Ku70 appears to inhibit participation of beta-catenin in this complex as siRNA against Ku70 increases the amount of beta-catenin in this complex. tcf7l2-parp1-5 3 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 5 D Nuclear extracts from DLD-1 cells untreated or treated with bleomycin were immunoprecipitated with anti-TCF-4 antibody. Although the total amount of Ku70 in the nucleus was not affected by bleomycin treatment (Fig. 5D, Nuclear), the amount of Ku70 coimmunoprecipitated with the anti-TCF-4 antibody was significantly increased (Fig. 5D, *). On the other hand, the amounts of PARP-1 and beta-catenin coimmunoprecipitated with anti-TCF-4 antibody were decreased The amount of Ku70 coimmunoprecipitated was increased by bleomycing treatment (which causes DNA-damaging alkylation).