IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Tribbles homolog 2 inactivates C/EBPalpha and causes acute myelogenous leukemia. Tribbles homolog 2 inactivates C/EBPalpha and causes acute myelogenous leukemia. Cancer Cell (1535-6108) 2006 imex curation Keeshan K., He Y., Wouters BJ., Shestova O., Xu L., Sai H., Rodriguez CG., Maillard I., Tobias JW., Valk P., Carroll M., Aster JC., Delwel R., Pear WS. Cancer - Interactions investigated in the context of cancer wpear@mail.med.upenn.edu Only protein-protein interactions 1 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa antibody detection identification by antibody antibody detection Keeshan K., He Y., Wouters BJ., Shestova O., Xu L., Sai H., Rodriguez CG., Maillard I., Tobias JW., Valk P., Carroll M., Aster JC., Delwel R., Pear WS. Cancer - Interactions investigated in the context of cancer wpear@mail.med.upenn.edu Accepted 2006-DEC-4 by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 1 imex curation Tribbles homolog 2 inactivates C/EBPalpha and causes acute myelogenous leukemia. Tribbles homolog 2 inactivates C/EBPalpha and causes acute myelogenous leukemia. Cancer Cell (1535-6108) 2006 imex curation Keeshan K., He Y., Wouters BJ., Shestova O., Xu L., Sai H., Rodriguez CG., Maillard I., Tobias JW., Valk P., Carroll M., Aster JC., Delwel R., Pear WS. Cancer - Interactions investigated in the context of cancer wpear@mail.med.upenn.edu Only protein-protein interactions 1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Keeshan K., He Y., Wouters BJ., Shestova O., Xu L., Sai H., Rodriguez CG., Maillard I., Tobias JW., Valk P., Carroll M., Aster JC., Delwel R., Pear WS. Cancer - Interactions investigated in the context of cancer wpear@mail.med.upenn.edu Accepted 2006-DEC-4 by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 1 imex curation g_csf_human_dna Human granulocyte colony stimulating factor receptor promoter oligonucleotide ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) AAGGTGGTGCAATCCCCAGC FF82D126129D727A trib2_mouse Tribbles homolog 2 Trib2 protein protein mouse Mus musculus Mouse MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFEISCYQESLAPCFCLSAHSNINQITEILLGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSGFGAKEACDQLVPDVNMEENLDPFFN 9418B7AC19FCC23F cebpa_human CCAAT/enhancer-binding protein alpha CEBPA CEBP protein protein human Homo sapiens Human MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA 574C0A049E25BCAC cebpa_rat CCAAT/enhancer-binding protein alpha Cebpa protein protein rat Rattus norvegicus (Rat) Rat MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA 4DA8F112F6EA95D0 cebpa-g_csf_human_dn 1 3 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells physical association physical association 5 E The C/EBPa-DNA binding activity was markedly reduced by Trib2 (Figure 5E, lanes 1 and 3), with the specificity of the observed gel shift being confirmed by production of a supershift upon addition of an antibody against C/EBPa This interaction occurs in cells transduced with MigR1. Trib2 expression inhibits the binding of C/EBPalpha to the G-CSF receptor promoter. cebpa-g_csf_human_dn 1 3 unspecified role unspecified role neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells physical association physical association 5 E The C/EBPa-DNA binding activity was markedly reduced by Trib2 (Figure 5E, lanes 1 and 3), with the specificity of the observed gel shift being confirmed by production of a supershift upon addition of an antibody against C/EBPa Trib2 expression inhibits the binding of C/EBPalpha to the G-CSF receptor promoter. P05554 transduction trib2-cebpa 2 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey n-terminal N-terminal truncation sufficient to bind sufficient binding region sufficient to bind n-term range n-terminal range n-term range n-term range n-terminal range n-term range region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7 B In coimmunoprecipitation experiments using 293T cells, Trib2 association with C/EBPap42 was detected only in the presence of MG132, whereas C/EBPap30 coimmunoprecipitated in the presence and absence of MG132 The N-terminally truncated C/EBPalphap30 coimmunoprecipitated with Trib2 in the presence or absence of MG132 The full-length C/EBPalphap42 only coimmunoprecipitated with Trib2 in the presence of the proteasome inhibitor MG132. I was not able to find the start position of the N-terminally truncated p30 protein.