IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. Cancer Cell (1535-6108) 2006 imex curation Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer anthony_letai@dfci.harvard.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 30 in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Accepted 2006-OCT-4 by ORCHARD. 30-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 30 imex curation Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. Mitochondria primed by death signals determine cellular addiction to antiapoptotic BCL-2 family members. Cancer Cell (1535-6108) 2006 imex curation Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer anthony_letai@dfci.harvard.edu 30-OCT-2006: Contacted by JYOTI. Only protein-protein interactions 30 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Certo M., Del Gaizo Moore V., Nishino M., Wei G., Korsmeyer S., Armstrong SA., Letai A. Apoptosis - Interactions involving proteins with a function related to apoptosis anthony_letai@dfci.harvard.edu Accepted 2006-OCT-4 by ORCHARD. 30-OCT-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 30 imex curation bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK DIP protein Q13323 original sequence version: 131 DIP protein Q13323 original sequence version: 119 89034F4443F5A136 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 b2la1_human Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein Protein GRS BCL2A1 BCL2L5 BFL1 GRS HBPA1 Bcl-2-like protein 5 protein protein human Homo sapiens Human MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC 329D98AF2BE07A0D bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN DIP protein Q9BXH1 original sequence version: 32 3585527F1858A4FA b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ DIP protein Q61337 original sequence version: 60 6C2BA910205053F7 apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT DIP protein Q9JM54 original sequence version: 102 DIP protein Q9JM54 original sequence version: 115 9B9A5B04D5535E30 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK E09D3CDD851AE9BE hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL 22E45FA2B0B7AA00 mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bmf_mouse Bcl-2-modifying factor Bmf protein protein mouse Mus musculus Mouse MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQENREGVGPW DIP protein Q91ZE9 original sequence version: 42 DAE6EA080F3EA06B bcl2-bid 1 11 unspecified role unspecified role neutral component neutral component n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:51:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90ala,asp95ala' Tue Jun 30 15:54:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Ala;Asp95Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, bcl2-bad 1 11 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain LWAAQRYGRE LRRMSDEFEG SFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2-bim-alpha1 1 11 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecobb Escherichia coli (strain B / BL21) 15 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B, 3 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. The Kd is under 1.0 E-8 M. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, BAD BH3 domain displaces BIM BH3 from Bcl-2 (but NOXA A BH3 does not). BAD BH3 efficiently displaces BIM BH3 from BCL-2, bcl2-bik 1 3 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. bcl2-bbc3 1 11 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. bcl2-bmf 1 16 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component n-terminal protein with c-terminal transmembrane region removed to increase solubility sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-2 was removed to improve solubility but they do not give the residues. The position of this region was taken from the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. bcl2l2-bid 1 6 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:19:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90ala,asp95ala' Tue Jun 30 17:34:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Ala;Asp95Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, bcl2l1-bim-alpha1 1 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 15 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, bcl2l1-bad 1 9 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain LWAAQRYGRELRRMSDEFEGSFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 10 E-8 M. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2l1-bik-1 1 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l1-hrk 1 13 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain SSAAQLTAARLKALGDELHQ sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. BCL-XL may be distinguished from BCL-2 and BCL-w by its much greater affinity for HRK BH3. BCL-XL is the only protein tested here that binds HRK BH3. bcl2l1-bbc3 1 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is less than 1.0 E-8 M. bcl2l1-bmf 1 16 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. The Kd is less than 1.0 E-8 M. bcl2l1-bid-1 1 6 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:47:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90ala,asp95ala' Tue Jun 30 17:35:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Ala;Asp95Ala]' region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-XL was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, bcl2l2-bim-alpha1 1 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 15 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, bcl2l2-bad 1 9 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain LWAAQRYGRE LRRMSDEFEG SFKGL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note that the Interpro entry for BH domain states that Bad does not contain a BH3 domain. bcl2l2-bik 1 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bbc3 1 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. bcl2l2-bmf 1 16 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. mcl1-bid 1 6 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:58:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90ala,asp95ala' Tue Jun 30 18:15:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Ala;Asp95Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, mcl1-bim-alpha1 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 15 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B, 3 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is under 1.0 E-8 M. It is also notable that the activators BID and BIM BH3 are bound by all of the antiapoptotics tested, NOXA A BH3 displaces BIM from Mcl-1, (but BAD BH3 does not). NOXA A BH3 efficiently displaces BIM from MCL-1 mcl1-bik 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain MEGSDALALRLACIGDEMDV sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. mcl1- pmaip1 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain AELPPEFAAQLRKIGDKVYC (NOXA A) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. It is significant that, while the other four proteins interact with neither of the NOXA BH3 domains tested, MCL-1 interacts with both. mcl1- pmaip1-1 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain PADLKDECAQLRRIGDKVNL (NOXA B) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. It is significant that, while the other four proteins interact with neither of the NOXA BH3 domains tested, MCL-1 interacts with both. mcl1-bbc3 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The Kd is less than 1.0 E-8 M. mcl1-bmf 1 14 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 16 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain HQAEVQIARKLQLIADQFHR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Mcl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Note this peptide has an extra HisGln at the n-terminus and at position 140 a Leu instead of a Cys. bcl2a1-bid 1 5 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component region peptide containing BH3 domain EDIIRNIARHL AQVGDSMDR sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range P55957:p.[Leu90Ala;Asp95Ala] mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:48:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu90ala,asp95ala' Tue Jun 30 18:44:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu90Ala;Asp95Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Also distinct is BFL-1. While it binds BID and BIM, it binds only PUMA among the sensitizers tested. bcl2a1-bim-alpha1 1 15 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain MRPEIWIAQELRRIGDEFNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Also distinct is BFL-1. While it binds BID and BIM, it binds only PUMA among the sensitizers tested. bcl2a1-bbc3 1 7 unspecified role unspecified role neutral component neutral component n-terminal fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range region peptide containing BH3 domain EQWAREIGAQLRRMADDLNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 1 B The authors state that the c-terminal transmembrane region of Bfl-1 was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. Also distinct is BFL-1. While it binds BID and BIM, it binds only PUMA among the sensitizers tested. BFL-1 is distinct as while it binds BID and BIM, it binds only PUMA among the sensitizers tested. bcl2l2-bid-1 2 4 unspecified role unspecified role prey prey c-terminal Bid was cleaved by caspase 8 to yield tBid (c-terminal fragment) sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P70444:p.[Cys30Ser;Cys126Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:53:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys30ser,cys126ser' Tue Jun 30 18:20:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys30Ser;Cys126Ser]' ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q92843:p.Arg95Pro mutation in the BH1 domain mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R P Wed May 02 19:39:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg95pro' Tue Jun 30 19:21:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg95Pro' ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A The authors state that the c-terminal transmembrane region of Bcl-w was removed to improve solubility but they do not give the residues. The position of this region is not found in the Uniprot annotation. The site cleaved in murine Bid by caspase 8 to yield tBid is suggested to be Asp59 by the literature. The BH3 domains of Bad, Bik, Puma and Bmf are able to displace tBid from Bcl-w. tBID is displaced from BCL-w by sensitizer BH3 peptides in a pattern that replicates the pattern in Figure 2D.