IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. J. Biol. Chem. (0021-9258) 2006 imex curation Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu Accepted 2007-Not a month!-13 by DAVET. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 davet Only protein-protein interactions imex curation In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. J. Biol. Chem. (0021-9258) 2006 imex curation Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu Accepted 2007-Not a month!-13 by DAVET. J. Biol. Chem. (0021-9258) 2006 davet Only protein-protein interactions imex curation In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. J. Biol. Chem. (0021-9258) 2006 imex curation Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu Accepted 2007-Not a month!-13 by DAVET. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 davet Only protein-protein interactions imex curation In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. J. Biol. Chem. (0021-9258) 2006 imex curation Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu Accepted 2007-Not a month!-13 by DAVET. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 davet Only protein-protein interactions imex curation In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. In prostate cancer cells the interaction of C/EBPalpha with Ku70, Ku80, and poly(ADP-ribose) polymerase-1 increases sensitivity to DNA damage. J. Biol. Chem. (0021-9258) 2006 imex curation Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yin H., Glass J. Cancer - Interactions investigated in the context of cancer Du145 cells were transduced with retrovirus carrying rat C/EBPalpha cDNA, leading to overexpression of the protein. Exogenously expressed C/EBPalpha was immunoprecipitated from cell lysates and coimmunoprecipitated proteins identified by Western blot. In the materials and methods, rat and human C/EBPalpha constructs are described. The rat construct was used for transductions, but it is not clear which construct was used in other experiments. Thus pull down experiment data has not been added. hyin@lsuhsc.edu Accepted 2007-Not a month!-13 by DAVET. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 davet Only protein-protein interactions imex curation cebpa_human CCAAT/enhancer-binding protein alpha CEBPA CEBP protein protein human Homo sapiens Human MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA 574C0A049E25BCAC xrcc5_human X-ray repair cross-complementing protein 5 XRCC5 G22P2 ATP-dependent DNA helicase II 80 kDa subunit Lupus Ku autoantigen protein p86 86 kDa subunit of Ku antigen Ku86 Ku80 Thyroid-lupus autoantigen CTC box-binding factor 85 kDa subunit Nuclear factor IV DNA repair protein XRCC5 X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining) ATP-dependent DNA helicase 2 subunit 2 protein protein human Homo sapiens Human MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI DIP protein P13010 original sequence version: 128 DIP protein P13010 original sequence version: 127 DIP protein P13010 original sequence version: 122 DIP protein P13010 original sequence version: 174 DIP protein P13010 original sequence version: 153 DIP protein P13010 original sequence version: 155 DIP protein P13010 original sequence version: 142 2363CA84834E74A3 cebpa_rat CCAAT/enhancer-binding protein alpha Cebpa protein protein rat Rattus norvegicus (Rat) Rat MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAAGLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA 4DA8F112F6EA95D0 parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW DIP protein P09874 original sequence version: 189 DIP protein P09874 original sequence version: 183 DIP protein P09874 original sequence version: 166 DIP protein P09874 original sequence version: 117 DIP protein P09874 original sequence version: 143 DIP protein P09874 original sequence version: 136 DIP protein P09874 original sequence version: 137 DIP protein P09874 original sequence version: 147 DIP protein P09874 original sequence version: 193 DIP protein P09874 original sequence version: 202 DIP protein P09874 original sequence version: 171 DIP protein P09874 original sequence version: 153 DIP protein P09874 original sequence version: 175 6A5FC01EB91C046B xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB cebpa-g22p1-1 2 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Clones of the prostate cancer cell lines LNCaP, Du145, and PC3 were generated through retrovirus transformation using the full-length rat C/EBP cDNA inserted into the retrovirus vector PLNCX. The increased expression of C/EBP was seen in all transduced cell lines. Although the p42 isoform was the predominant isoform, the p30 isoform was detected in transduced LNCaP cells (Fig. 2D, right panel). As shown in Fig. 2E, in all three lines Ku70, Ku80, and PARP-1 co-precipitated with C/EBP 2 E P05554 transduction P05554 over-expressed cebpa-g22p1-2 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Clones of the prostate cancer cell lines LNCaP, Du145, and PC3 were generated through retrovirus transformation using the full-length rat C/EBP cDNA inserted into the retrovirus vector PLNCX. The increased expression of C/EBP was seen in all transduced cell lines. Although the p42 isoform was the predominant isoform, the p30 isoform was detected in transduced LNCaP cells (Fig. 2D, right panel). As shown in Fig. 2E, in all three lines Ku70, Ku80, and PARP-1 co-precipitated with C/EBP 2 E P05554 transduction P05554 over-expressed cebpa-g22p1-3 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Clones of the prostate cancer cell lines LNCaP, Du145, and PC3 were generated through retrovirus transformation using the full-length rat C/EBP cDNA inserted into the retrovirus vector PLNCX. The increased expression of C/EBP was seen in all transduced cell lines. Although the p42 isoform was the predominant isoform, the p30 isoform was detected in transduced LNCaP cells (Fig. 2D, right panel). As shown in Fig. 2E, in all three lines Ku70, Ku80, and PARP-1 co-precipitated with C/EBP 2 E P05554 transduction P05554 over-expressed Among the three transduced cell lines PC3 showed the weakest interaction of C/EBPalpha with Ku proteins and PARP-1. After incubation of the PC3 cells with bleomycin (50 or 100 milliunits/ml) and iron (2.5 E-6 M ferric chloride and 2.5 E-6 M ferrous sulphate) for 24 h, the amount of Ku70, Ku80, and PARP-1 that co-precipitated with C/EBPalpha increased by 6.6, 2.7, and 1.7-fold, respectively. Induction of double-strand DNA breaks (e.g., by treatment with bleomycin and iron) strengthens these interactions. cebpa-g22p1-5 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 2 F Ku70, Ku80, and PARP-1 also co-precipitated with endogenous C/EBP as was demonstrated in LNCaP cells cebpa-g22p1-6 5 6 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 2 F Ku70, Ku80, and PARP-1 also co-precipitated with endogenous C/EBP as was demonstrated in LNCaP cells (Fig. 2F, top panel) and in human prostate cancer tissue These interactions were detected in all three samples. cebpa-parp1-1 5 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2 F Ku70, Ku80, and PARP-1 also co-precipitated with endogenous C/EBP as was demonstrated in LNCaP cells (Fig. 2F, top panel) and in human prostate cancer tissue The C/EBPalpha interaction with PARP-1 was detected in two of the three samples but not in the third, where PARP-1 was detected only in small fragments.