IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. Nucleic Acids Res. (0305-1048) 2005 imex curation Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu 26-APR-2007: Contacted by JYOTI. orchard Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu Accepted 2007-MAY-3 by ORCHARD. 26-APR-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2005 orchard Only protein-protein interactions imex curation The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. Nucleic Acids Res. (0305-1048) 2005 imex curation Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu 26-APR-2007: Contacted by JYOTI. orchard Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu Accepted 2007-MAY-3 by ORCHARD. 26-APR-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2005 orchard Only protein-protein interactions imex curation The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. Nucleic Acids Res. (0305-1048) 2005 imex curation Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu 26-APR-2007: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu Accepted 2007-MAY-3 by ORCHARD. 26-APR-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2005 orchard Only protein-protein interactions imex curation The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. The ErbB3 binding protein Ebp1 interacts with Sin3A to repress E2F1 and AR-mediated transcription. Nucleic Acids Res. (0305-1048) 2005 imex curation Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu 26-APR-2007: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang Y., Akinmade D., Hamburger AW. Cancer - Interactions investigated in the context of cancer By reference to papers written by those who made gifts of constructs it was determined that the EBP1 construct was human (Int J Cancer 120 1909, Br J Cancer 82 683) and the HDAC2 construct was human (Nature Genetics 23 464). ahamburg@umaryland.edu Accepted 2007-MAY-3 by ORCHARD. 26-APR-2007: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2005 orchard Only protein-protein interactions imex curation sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q96ST3 original sequence version: 128 DIP protein Q96ST3 original sequence version: 147 E6A329BE0EAD84CD hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA pa2g4_human Proliferation-associated protein 2G4 PA2G4 Cell cycle protein p38-2G4 homolog ErbB3-binding protein 1 EBP1 protein protein human Homo sapiens Human MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD DIP protein Q9UQ80 original sequence version: 148 CD45466507AD6047 e2f1_prom_human_dna Oligonucleotide derived from human E2F1 promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) GGCTCTTTCGCGGCAAAAAGGATTTGGCGCGTAAAA FF0A99FC7972394E sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 pa2g4-sin3a 4 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range Q9UQ80:p.Leu357_Leu358delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Wed May 02 20:05:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu357-358ala_ala' Tue Jun 30 17:47:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu357_Leu358delinsAlaAla' 5 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 1 A, 2 D we performed GST pull-down assays using HeLa cell lysates. Western blot analysis demonstrated that Sin3A specifically associated with GST-Ebp1 Full-length EBP1 is stated to be 372 aa by the authors but the UniProtKb entry is a sequence of 394 aa. pa2g4-sin3a-1 1 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 B COS-7 cells were transfected with a myc-tagged Sin3A expression construct and a FLAG-tagged ebp1 expression construct. Cell lysates were immunoprecipitated with a polyclonal antibody to the myc-epitope tag and probed with a mouse monoclonal antibody to the FLAG-tag. Results indicated that Ebp1 was found in myc, but not isotype control, immunoprecipitates Q60520; Q9UQ80 transfection pa2g4-sin3a-2 2 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association 1 C Endogenous Sin3A was found in FLAG immunoprecipitates from the FLAG-Ebp1 sin3a-pa2g4 4 7 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association A fragment containing PAH4 and most of the C-terminal domain of Sin3A (545-1157) pulled down endogenous Ebp1. 3 B Sin3A (545-1157) contains PAH4 and most of the C-terminal domain. sin3a-hdac2 4 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association 3 B Sin3A (545-1157) contains PAH4 and most of the C-terminal domain. we showed that domain 545-1157 bound to HDAC2 pa2g4-sin3a-3 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UQ80:p.Leu357_Leu358delinsAlaAla mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Wed May 02 15:19:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu357-358ala_ala' Tue Jun 30 20:05:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu357_Leu358delinsAlaAla' region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 4 A GST-Ebp1, but not GST, bound full-length in vitro translated Sin3A protein The UniProtKb entry corresponding to EBP1 has a sequence of 394 aa whereas the authors state the sequence is 372 aa in length. sin3a-hdac2-1 3 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 4 B we incubated [35S] HDAC2 to GST�Sin3A. HDAC2 was able to bind to Sin3A directly e2f1_prom-pa2g4 4 7 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 9 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 8 unspecified role unspecified role bait bait association association GFP-Ebp1 was found associated with the E2F1 oligonucleotide. No GFP reactive proteins from lysates of cells that had not been transfected or cells that were transfected with the GFP vector alone (Figure 6B, upper panel) were found associated with the E2F1 oligo. Endogenous Ebp1 was also associated with the oligonucleotide, although binding was decreased in the GFP only transfected cells (Figure 6B, middle panel). Sin3A was found associated with the E2F1 consensus oligonucleotide in all three cell lysates. 6 B The E2F1 promoter-based oligonucleotide was biotinylated. Q9UQ80 transfection e2f1_prom-pa2g4-1 4 7 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells association association GFP-Ebp1 was found associated with the E2F1 oligonucleotide. No GFP reactive proteins from lysates of cells that had not been transfected or cells that were transfected with the GFP vector alone (Figure 6B, upper panel) were found associated with the E2F1 oligo. Endogenous Ebp1 was also associated with the oligonucleotide, although binding was decreased in the GFP only transfected cells (Figure 6B, middle panel). Sin3A was found associated with the E2F1 consensus oligonucleotide in all three cell lysates. 6 B The E2F1 promoter-based oligonucleotide was biotinylated.