IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. Oncogene (0950-9232) 2006 imex curation Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer BioCreative - Critical Assessment of Information Extraction systems in Biology borzacch@unina.it 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions bovin-urin_bladder_carcino Bos taurus urinary bladder carcinoma urinary_bladder_carcinoma urinary bladder carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer borzacch@unina.it Accepted 2006-SEP-18 by JYOTI. 14-DEC-2006: Contacted by JYOTI. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. Bovine papillomavirus E5 oncoprotein binds to the activated form of the platelet-derived growth factor beta receptor in naturally occurring bovine urinary bladder tumours. Oncogene (0950-9232) 2006 imex curation Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer BioCreative - Critical Assessment of Information Extraction systems in Biology borzacch@unina.it 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions bovin-urin_bladder_carcino Bos taurus urinary bladder carcinoma urinary_bladder_carcinoma urinary bladder carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Borzacchiello G., Russo V., Gentile F., Roperto F., Venuti A., Nitsch L., Campo MS., Roperto S. Cancer - Interactions investigated in the context of cancer borzacch@unina.it Accepted 2006-SEP-18 by JYOTI. 14-DEC-2006: Contacted by JYOTI. Oncogene (0950-9232) 2006 Only protein-protein interactions imex curation q0vc10_bovin PDGFRB protein protein bovin Bos taurus (Bovine) Bovine MWLPSAMQAVVLKGRVLLLPLLFLLGPQASWGLAIIPPGPELVLNLSSTFVLTCSGPAPVVWERMSQKPPQEMTETQDGTFSSVLTLVNVTGLDTGEYFCGYKRSHGLEASERKRLYIFVPDPSVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVMLHEKKVDVPLPIAYDPQRGFSGTFEDKTYICKTTIGDREVDSDAYHVYSLQGEPPFWPGAQPRQV 488D335C9F637965 q6xhb4_bpv2 E5 protein protein bpv2 Bovine papillomavirus type 2 MPNLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF 0E278099E06F2956 q6xhb4-pdgfrb 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 A, 4 B Three different BPV-2-positive bovine bladder cancer samples were tested. The same protein lysates in which PDGF b receptor hadbeen detected(Figure 1) were immunoprecipitatedeither with anti-E5 antibody or with anti-PDGF b receptor antibody #1. The immunoprecipitates were probedfor the presence of the PDGF b receptor or of E5 by Western blotting with the respective antibodies. PDGF b receptor was detected in E5 immunoprecipitates A single strong band of the expected molecular size, corresponding to the PDGF b receptor, was obtained(Figur e 4b), showing that the receptor in complex with E5 is phosphorylated. q6xhb4-pdgfrb-1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 3 B Three different BPV-2-positive bovine bladder cancer samples were tested. The same protein lysates in which PDGF b receptor hadbeen detected(Figure 1) were immunoprecipitatedeither with anti-E5 antibody or with anti-PDGF b receptor antibody #1. The immunoprecipitates were probedfor the presence of the PDGF b receptor or of E5 by Western blotting with the respective antibodies. PDGF b receptor was detected in E5 immunoprecipitates (Figure 3a) and, conversely, E5 was detected in PDGF b receptor immunoprecipitates q6xhb4-pdgfrb-2 1 3 unspecified role unspecified role neutral component neutral component region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 m-o Most cells in the neoplastic urothelium showedcytopl asmic colocalization of E5 andPDGF b receptor, as judged by the yellow fluorescence of the mergedimages