IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transcriptional factor FOXL2 interacts with DP103 and induces apoptosis. Transcriptional factor FOXL2 interacts with DP103 and induces apoptosis. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Lee K., Pisarska MD., Ko JJ., Kang Y., Yoon S., Ryou SM., Cha KY., Bae J. Cancer - Interactions investigated in the context of cancer Apoptosis - Interactions involving proteins with a function related to apoptosis jeehyeon@cha.ac.kr Rat ovarian cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Lee K., Pisarska MD., Ko JJ., Kang Y., Yoon S., Ryou SM., Cha KY., Bae J. Cancer - Interactions investigated in the context of cancer jeehyeon@cha.ac.kr Accepted 2006-JUN-9 by ORCHARD. Rat ovarian cDNA library Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation Transcriptional factor FOXL2 interacts with DP103 and induces apoptosis. Transcriptional factor FOXL2 interacts with DP103 and induces apoptosis. Biochem. Biophys. Res. Commun. (0006-291X) 2005 imex curation Lee K., Pisarska MD., Ko JJ., Kang Y., Yoon S., Ryou SM., Cha KY., Bae J. Cancer - Interactions investigated in the context of cancer Apoptosis - Interactions involving proteins with a function related to apoptosis jeehyeon@cha.ac.kr Rat ovarian cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee K., Pisarska MD., Ko JJ., Kang Y., Yoon S., Ryou SM., Cha KY., Bae J. Cancer - Interactions investigated in the context of cancer jeehyeon@cha.ac.kr Accepted 2006-JUN-9 by ORCHARD. Rat ovarian cDNA library Biochem. Biophys. Res. Commun. (0006-291X) 2005 Only protein-protein interactions imex curation foxl2_human Forkhead box protein L2 FOXL2 protein protein human Homo sapiens Human MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLDL B4952F2A0380E533 q9jik3_rat protein protein rat Rattus norvegicus (Rat) Rat ENMMMKIAQKCNINLLPLPDPIPAGLMEECLDCDVEVKAAMHTYSSPSISTQSPKKQVQKPERAFQSQRTPGSHMPSPRNTSVSTLSAKSKHGKQKLPVKSHSECGILEKAAPPQELDCTTHPEEQVKNSVQTSTEDSSSNSQHQAKETSPGSLPKIPCLSSFKVHQPSALTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGAQTVNPQNGFVRNRVSADRVQMLVSSSQSGDSESESDSCSSRTSSQSKGNKSYLEGSSDTQLKDSECTSVGGPLSLEQIQNGNDTSTQVEYQESPETQVKARHKEGANQRSKPSRRNPPRRSSYRVQTEAQEEGWHDCHRETNASSSDPYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTVYLQEMMRGNQ 40ED260849B86807 ddx20_mouse Probable ATP-dependent RNA helicase DDX20 Ddx20 Dp103 Gemin3 DEAD box protein 20 DEAD box protein DP 103 Component of gems 3 Gemin-3 Regulator of steroidogenic factor 1 protein protein mouse Mus musculus Mouse MAAAAFEVPAALTTSESTMAAERAAAPVQAVEPTPASPWTQRTAHDIGGPRTRTGDVVLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLILENYSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEVLANALTRYMRDPTFVRLNPSDPSLIGLKQYYQVVNSYPLAHKIFEEKTQHLQELFSKVPFNQALVFSNLHSRAQHLADILSSKGFPTECISGNMNQNQRLDAMAKLKQFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMKIAQKCNINLLPLPDPIPPGLMEECLNWDVEVKAAMHTYSSPTVATQSPKKQVQKLERAFQSQRTPGNQTPSPRNTSASALSARPKHSKPKLPVKSHSECGVLEKAAPPQESGCPAQLEEQVKNSVQTSVEDSSSNSQHQAKDSSPGSLPKIPCLSSFKVHQPSTLTFAELVDDYEHYIKEGLEKPVEIIRHYTGPEAQTGNPQNGFVRNRVSEDRAQMLVSSSQSGDSESDSDSCSSRTSSQSKGNKSYLEGSSDTQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQRSKQSRRNPARRSSYRVQSEPQEESWYDCHRETTASFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTVYLQEMMRGNQ B5BCD0754D4075C3 foxl2-dp103-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association foxl2-dp103-2 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association