IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Eur. J. Cell Biol. (0171-9335) 2004 imex curation de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl Accepted 2006-DEC-12 by JYOTI. 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Eur. J. Cell Biol. (0171-9335) 2004 imex curation de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl Accepted 2006-DEC-12 by JYOTI. 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Eur. J. Cell Biol. (0171-9335) 2004 imex curation de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl Accepted 2006-DEC-12 by JYOTI. 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Testis-specific human small heat shock protein HSPB9 is a cancer/testis antigen, and potentially interacts with the dynein subunit TCTEL1. Eur. J. Cell Biol. (0171-9335) 2004 imex curation de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined de Wit NJ., Verschuure P., Kappe G., King SM., de Jong WW., van Muijen GN., Boelens WC. Cancer - Interactions investigated in the context of cancer W.Boelens@ncmls.kun.nl Accepted 2006-DEC-12 by JYOTI. 21-Dec-2006: Contacted by JYOTI. The library pJG-HeLa (HeLa cell line) was used. Eur. J. Cell Biol. (0171-9335) 2004 Only protein-protein interactions imex curation nudt5_human ADP-sugar pyrophosphatase Nucleoside diphosphate-linked moiety X motif 5 YSA1H NUDT5 HSPC115 8-oxo-dGDP phosphatase NUDIX5 Nuclear ATP-synthesis protein NUDIX5 protein protein human Homo sapiens Human MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF 6574E0BF1EA2BB26 ctcf_human Transcriptional repressor CTCF CCCTC-binding factor CTCFL paralog 11-zinc finger protein CTCF protein protein human Homo sapiens Human MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR DIP protein P49711 original sequence version: 116 2110538B65DC5706 hspb9_human Heat shock protein beta-9 Cancer/testis antigen 51 HSPB9 protein protein human Homo sapiens Human MQRVGNTFSNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHARDGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTAMTCCLTPSGQLWVRGQCVALALPEAQTGPSPRLGSLGSKASNLTR F28E40D0512C4997 dylt1_human Dynein light chain Tctex-type 1 T-complex testis-specific protein 1 homolog Protein CW-1 DYNLT1 TCTEL1 TCTEX1 TCTEX-1 protein protein human Homo sapiens Human MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI DIP protein P63172 original sequence version: 37 A6BAD1D0744D1AA6 hspb9_mouse Heat shock protein beta-9 Hspb9 protein protein mouse Mus musculus Mouse MQRVGSSFSTGQREPGENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPSFQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQNKCLPPPEAQTGQSQKPRRGGPKSSLQNESVKNP 7A77ED458F31D315 hspb9-dynlt1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 4 TCTEL1 (t-complex testis expressed protein 1) was found as HSPB9-interacting protein in both libraries hspb9-dynlt1-1 2 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 4 TCTEL1 (t-complex testis expressed protein 1) was found as HSPB9-interacting protein in both libraries hspb9-ctcf 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 4 TCTEL1 (t-complex testis expressed protein 1) was found as HSPB9-interacting protein in both libraries, while CTCF (CCCTC-binding factor; zinc finger protein), NUDT5 (nudix hydrolase) and an unknown protein (not similar to a known protein using BLAST search) were only found in the HeLa library. hspb9-nudt5 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 4 TCTEL1 (t-complex testis expressed protein 1) was found as HSPB9-interacting protein in both libraries, while CTCF (CCCTC-binding factor; zinc finger protein), NUDT5 (nudix hydrolase) and an unknown protein (not similar to a known protein using BLAST search) were only found in the HeLa library. hspb9-dynlt1-2 4 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 4 When tested for interaction with TCTEL1, the C-terminus was positive, while the N-terminus was negative hspb9-dynlt1-3 4 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Table 4 We therefore tested whether mouse HSPB9 could bind human TCTEL1, and found indeed interaction, but not as strong as for human HSPB9 The interaction of human TCTEL1 with mouse HSPB9 was not as strong as with human HSPB9. dynlt1-dynlt1 4 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Table 4 hspb9-dynlt1-4 4 7 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait physical association physical association Table 4 When tested for interaction with TCTEL1, the C-terminus was positive, while the N-terminus was negative hspb9-dynlt1-5 4 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 4 We therefore tested whether mouse HSPB9 could bind human TCTEL1, and found indeed interaction, but not as strong as for human HSPB9 The interaction of human TCTEL1 with mouse HSPB9 was not as strong as with human HSPB9. hspb9-dynlt1-6 3 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region VSV tag (EIYTDIEMNRLGK) tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 By immunoprecipitation with antiserum against HSPB9 between 10 and 20%HSPB9 was precipitated (data not shown) and about 0.5% VSV-tagged TCTEL1 could be co-precipitated and immunodetected Q9BQS6; P63172 transfection