IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. Infect. Immun. (0019-9567) 2004 imex curation Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down edman degradation edman degradation Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de Accepted 2010-APR-24 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Infect. Immun. (0019-9567) 2004 orchard Only protein-protein interactions imex curation Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. Alpha 1-antitrypsin binds to and interferes with functionality of EspB from atypical and typical enteropathogenic Escherichia coli strains. Infect. Immun. (0019-9567) 2004 imex curation Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Knappstein S., Ide T., Schmidt MA., Heusipp G. Cancer - Interactions investigated in the context of cancer infekt@uni-muenster.de Accepted 2010-APR-24 by ORCHARD. Infect. Immun. (0019-9567) 2004 orchard Only protein-protein interactions imex curation p71213_ecolx espB EKI52_12965 C6N50_004400 CCV24_001216 CX694_003167 CYM75_002980 F9V22_21585 G4A38_02845 GFZ60_21045 A8X14_001698 AAG80_002511 ABE90_023190 B6R12_005072 B6R15_003131 BMC34_002600 ERS085386_04437 ERS085411_04537 BJJ90_23555 NCTC8960_02077 DIV22_19905 E2119_26280 GGB84_001983 GF199_10240 protein protein ecolx Escherichia coli MNTIDYTNQVMTVNSVSENTTGSNAITASAINSSLLTDGKVDVSKLMLEIQKLLGKMVRILQDYQQQQLSQSYQIQLAVFESQNKAIDEKKAAATAALVGGAISSVLGILGSFAAINSATKGASDIAQKTASTSSKAIDAASDTATKTLTKATESVADAVEDASSVMQQAMTTATRAASRTSDVADDIADSAQRASQLAENAADAAQKASRASRFMAAVDKITGSTPFIAVTSLAEGTKTLPTTVSESVKSNHEISEQRYKSVENFQQGNLDLYKQEVRRAQDDIASRLRDMTTAARDLTDLQNRMGQSVRLAG D9B781454CCA5267 a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK DIP protein P01009 original sequence version: 186 DIP protein P01009-1 original sequence version: 182 7016555F273B7F16 espb-aat 1 3 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey physical association physical association Fig. 1 espb-aat-1 2 4 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig. 1 Binding of AAT to rEspB in a pull-down assay espb-aat-2 1 4 unspecified role unspecified role prey prey human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 3 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecobb Escherichia coli (strain B / BL21) physical association physical association Fig. 1 Binding of AAT to rEspB in a pull-down assay