IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. J. Biol. Chem. (0021-9258) 2001 imex curation Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu orchard Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu Accepted 2007-DEC-28 by ORCHARD. J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. ERK regulates the hepatocyte growth factor-mediated interaction of Gab1 and the phosphatidylinositol 3-kinase. J. Biol. Chem. (0021-9258) 2001 imex curation Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. Cancer - Interactions investigated in the context of cancer To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu orchard Only protein-protein interactions mouse-mimcd_3 Mus musculus mIMDC-3 inner medullary collecting duct cells mimcd_3 mIMCD-3 (murine inner medullary collecting duct cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yu CF., Roshan B., Liu ZX., Cantley LG. Synapse - Interactions of proteins with an established role in the presynapse. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. To determine the nature of the p85 construct, a paper (PMID 7935461) by the donor, Dr. L. Rameh, of the construct was consulted. This paper referred to PMID 1372091 which gave a reference to PMID 1849461, containing the required information. chengfang.yu@yale.edu Accepted 2007-DEC-28 by ORCHARD. J. Biol. Chem. (0021-9258) 2001 orchard Only protein-protein interactions imex curation grb2_mouse Growth factor receptor-bound protein 2 Grb2 Adapter protein GRB2 SH2/SH3 adapter GRB2 protein protein mouse Mus musculus Mouse MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV 97F4A4FE4B248DDF gab1_mouse GRB2-associated-binding protein 1 Growth factor receptor bound protein 2-associated protein 1 GRB2-associated binder 1 Gab1 protein protein mouse Mus musculus Mouse MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEDMNKWVRCICDICGFNPTEEDPVKPLTGSSQAPVDSPFAISTAPASSQMEASSVALPPPYQVISLPPHPDTLGLQDDPQDYLLLINCQSKKPEPNRTLFDSAKPTFSETDCNDNVPSHQTPASSQSKHGMNGFFQQQMMYDCPPSRLTSVSGESSLYNLPRSYSHDVLPKESPSSTEADGELYTFNTPSGTAGVETQMRHVSISYDIPPTPGNTYQIPRTFPESTLGQSSKLDTIPDIPPPRPPKPHPTHDRSPVETCGVPRTASDTDSSYCIPPPAGMTPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSLEGFHSQYKIKSVLTAGGVSGEELDENYVPMNPNSPPRQHSGSFTEPIQEPNYVPMTPGTFDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLDIKPLSEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSGEDPNLFASNSLDGGSSPMNKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSMADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPTKNVK DIP protein Q9QYY0 original sequence version: 91 F0A567896E058C58 p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR DIP protein P27986 original sequence version: 181 DIP protein P27986 original sequence version: 184 DIP protein P27986-1 original sequence version: 135 DIP protein P27986 original sequence version: 135 DIP protein P27986-1 original sequence version: 145 DIP protein P27986-1 original sequence version: 147 DIP protein P27986 original sequence version: 191 B9DAD8416C33140F pik3r1-gab1 1 4 unspecified role unspecified role prey prey mouse-mimcd_3 Mus musculus mIMDC-3 inner medullary collecting duct cells mimcd_3 mIMCD-3 (murine inner medullary collecting duct cells) 5 unspecified role unspecified role bait bait region N-SH2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region C-SH2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association 2 A HGF (hepatocyte growth factor) - HGF treatment stimulates this interaction. U0126 - U0126 , a MEK family kinase inhibitor, inhibits this interaction when cells are treated with HGF. gab1-grb2 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 4 A