MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Mol. Cell. Biol. (0270-7306) 2000 Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer jacques.landry@med.ulaval.ca 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis jacques.landry@med.ulaval.ca Accepted 2007-Not a month!-3 by DAVET. 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. Mol. Cell. Biol. (0270-7306) 2000 davet Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Mol. Cell. Biol. (0270-7306) 2000 Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer jacques.landry@med.ulaval.ca 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis jacques.landry@med.ulaval.ca Accepted 2007-Not a month!-3 by DAVET. 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. Mol. Cell. Biol. (0270-7306) 2000 davet Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Mol. Cell. Biol. (0270-7306) 2000 Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer jacques.landry@med.ulaval.ca 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. davet in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of protein Fas taken from PMID 11493600. jacques.landry@med.ulaval.ca Accepted 2007-Not a month!-3 by DAVET. 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. Mol. Cell. Biol. (0270-7306) 2000 davet Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Inhibition of Daxx-mediated apoptosis by heat shock protein 27. Mol. Cell. Biol. (0270-7306) 2000 Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer jacques.landry@med.ulaval.ca 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Charette SJ., Lavoie JN., Lambert H., Landry J. Apoptosis - Interactions involving proteins with a function related to apoptosis jacques.landry@med.ulaval.ca Accepted 2007-Not a month!-3 by DAVET. 01-Feb-2008: Contacted by JYOTI. A HeLa cell cDNA library was used. Mol. Cell. Biol. (0270-7306) 2000 davet hspb1_crilo Heat shock protein beta-1 Heat shock 27 kDa protein HSPB1 HSP27 protein protein crilo Cricetulus longicaudatus (Long-tailed hamster) Chinese hamster MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPGYVRPLPAATAEGPAAVALAAPLAAPAFHRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKTATQSAEITIPVTFEARAQIGGQEAGKSEQSGAK 29E633DBBFA3F89F tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 hspb1_human Heat shock protein beta-1 HSPB1 HSP27 HSP28 Heat shock 27 kDa protein Stress-responsive protein 27 Estrogen-regulated 24 kDa protein 28 kDa heat shock protein protein protein human Homo sapiens Human MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 1B4DC44A6F6606D5 1B4DC44A6F6606D5 m3k5_human Mitogen-activated protein kinase kinase kinase 5 MAPK/ERK kinase kinase 5 Apoptosis signal-regulating kinase 1 MAP3K5 ASK1 MAPKKK5 MEKK5 protein protein human Homo sapiens Human MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT DIP protein Q99683 original sequence version: 83 DIP protein Q99683 original sequence version: 151 DIP protein Q99683 original sequence version: 113 265BDC65968AF985 hspb1-daxx 2 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey c-teminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Among the positive clones obtained, four identical clones typified by clone 55.1 specifically interacted in a two-hybrid assay with HaHSP27 and HuHSP27, but not with ras (val 12) and lamin C (data not shown). Sequence analysis revealed that clone 55.1 corresponded to the carboxy terminus of the human Daxx protein from amino acid 472 to 740 hspb1-daxx-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 1 B The interaction between Daxx and HSP27 was confirmed in a GST pull-down assay. daxx-hspb1 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-teminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 1 C The interaction between Daxx and HSP27 was confirmed in a GST pull-down assay. hspb1-hspb1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 1 C HSP27 was retained on GST-HSP27 fas-daxx-4 3 7 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Death domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1 B, 3 A, B Daxx was retained on immobilized GST�Fas-DD The range for the Death domain of Fas is that given in the UniProtKB entry P25445. HSP27 - HSP27 inhibits this interaction. HSP27 (ser15ala,ser90ala) had little effect on the interaction, whereas HSP27 (ser15glu,ser90glu) was as effective, if not more effective, in blocking the interaction than wild-type HSP27. hspb1-daxx-2 1 7 unspecified role unspecified role prey prey c-terminal Fas Binding Domain (FBD) sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait physical association physical association 1 D Transient expression in yeast and immunoprecipitation indicated that the FBD domain of Daxx was sufficient to mediate the interaction of Daxx with HSP27. hspb1-daxx-3 4 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association 1 E In extracts from mammalian cells transfected with Myc-tagged FBD and HaHSP27, Myc-tagged FBD could be coimmunoprecipitated by HSP27 antibody L2R3 P15991; Q9UER7 transfection hspb1-hspb1-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey P15991:p.[Ser15Ala;Ser90Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:04:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser15ala,ser90ala' Tue Jun 30 17:24:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser15Ala;Ser90Ala]' P15991:p.[Ser15Glu;Ser90Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Wed May 02 17:50:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser15glu,ser90glu' Tue Jun 30 18:53:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser15Glu;Ser90Glu]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 2 In extracts from transfected 293 cells, HaHSP27-AA and HaHSP27-EE interacted efficiently with immobilized GSTHuHSP27 This indicates the mutant forms of HSP27 are functional. daxx-hspb1-1 3 5 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2 HaHSP27-EE interacted with the Daxx protein encoded by clone 55.1 much more efficiently than HaHSP27-AA The authors state that HaHSP27 (ser15glu,ser90glu) interacted with the Daxx protein (aa 472-740) much more efficiently than HaHSP27 (ser15ala,ser90ala). daxx-map3k5 3 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 3 C, D The interaction between Daxx and Ask1 was confirmed by showing that Ask1 from extracts of 293 cells was retained on immobilized GST-55.1 HSP27 - HSP27 inhibits this interaction. HSP27 (ser15ala,ser90ala) had little effect on the interaction, whereas HSP27 (ser15glu,ser90glu) was as effective, if not more effective, in blocking the interaction than wild-type HSP27.