IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Hepatology (0270-9139) 2000 imex curation Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov 14-Nov-2008: Contacted by JYOTI. Human fetal liver (Clontech). Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Accepted 2008-NOV-17 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Hepatology (0270-9139) 2000 imex curation Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov 14-Nov-2008: Contacted by JYOTI. Human fetal liver (Clontech). Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Accepted 2008-NOV-17 by ORCHARD. Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression. Hepatology (0270-9139) 2000 imex curation Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov 14-Nov-2008: Contacted by JYOTI. Human fetal liver (Clontech). Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Terai S., Aoki H., Ashida K., Thorgeirsson SS. Cancer - Interactions investigated in the context of cancer snorri_thorgeirsson@nih.gov Accepted 2008-NOV-17 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. Human fetal liver (Clontech). Hepatology (0270-9139) 2000 Only protein-protein interactions imex curation a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK DIP protein P01009 original sequence version: 186 DIP protein P01009-1 original sequence version: 182 7016555F273B7F16 id1_human DNA-binding protein inhibitor ID-1 ID1 ID Inhibitor of DNA binding 1 BHLHB24 Class B basic helix-loop-helix protein 24 Inhibitor of differentiation 1 protein protein human Homo sapiens Human MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR DIP protein P41134 original sequence version: 156 DIP protein P41134 original sequence version: 115 480287384B667161 id3_human DNA-binding protein inhibitor ID-3 ID3 1R21 BHLHB25 Inhibitor of DNA binding 3 ID-like protein inhibitor HLH 1R21 Helix-loop-helix protein HEIR-1 HEIR1 Class B basic helix-loop-helix protein 25 Inhibitor of differentiation 3 protein protein human Homo sapiens Human MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH DIP protein Q02535 original sequence version: 143 7FC38B56B4DCEFBC myod1_human Myoblast determination protein 1 Myogenic factor 3 MYOD1 MYF3 MYOD BHLHC1 Class C basic helix-loop-helix protein 1 protein protein human Homo sapiens Human MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPEEHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYAPGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRPGKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQSPDAAPQCPAGANPNPIYQVL 75E624D2ED5B0B33 id2_human DNA-binding protein inhibitor ID-2 Inhibitor of DNA binding 2 ID2 BHLHB26 Class B basic helix-loop-helix protein 26 Inhibitor of differentiation 2 protein protein human Homo sapiens Human MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG DIP protein Q02363 original sequence version: 133 DIP protein Q02363 original sequence version: 90 DIP protein Q02363 original sequence version: 144 A0D98B96396EB11E ccdb1_human Cyclin-D1-binding protein 1 Grap2 and cyclin-D-interacting protein Human homolog of Maid CCNDBP1 DIP1 GCIP HHM protein protein human Homo sapiens Human MASATAPAAAVPTLASPLEQLRHLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAAVTVSREATTLTIVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRGATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMCHLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQSELEL 40C7C3686632F6A7 p15923-1 Transcription factor E2-alpha PAN-2 TCF3 BHLHB21 E2A ITF1 Class B basic helix-loop-helix protein 21 Immunoglobulin enhancer-binding factor E12/E47 Immunoglobulin transcription factor 1 Kappa-E2-binding factor Transcription factor 3 Transcription factor ITF-1 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM 52F5E3DE1890AE13 tcf3-ccndbp1 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association In an attempt to identify partners for the E12 protein that may exert control during liver development, we performed the yeast 2-hybrid screen using an expression complementary DNA library from human fetal liver. A novel dominant inhibitory HLH factor, designated HHM (human homologue of maid), was isolated and characterized. tcf3-id1 2 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association A plasmid library representing the fetal human liver was screened with LexA-E12 bait in a yeast reporter strain. Of 1 3 106 independent clones screened, 92 clones with a Leu1 LacZ1 phenotype were obtained. The rep-resentative plasmids from each group of positives were retransformed back into yeast to confirm their correct phenotype. Finally, of 14 true positive clones, 5 independent clones were identified as follows: Id1 (5 clones), Id2 (4 clones), Id3 (3 clones), alpha-1-antitrypsin, and 1 clone encoding the unknown sequence. tcf3-id2 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association A plasmid library representing the fetal human liver was screened with LexA-E12 bait in a yeast reporter strain. Of 1 3 106 independent clones screened, 92 clones with a Leu1 LacZ1 phenotype were obtained. The rep-resentative plasmids from each group of positives were retransformed back into yeast to confirm their correct phenotype. Finally, of 14 true positive clones, 5 independent clones were identified as follows: Id1 (5 clones), Id2 (4 clones), Id3 (3 clones), alpha-1-antitrypsin, and 1 clone encoding the unknown sequence. tcf3-id3 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association A plasmid library representing the fetal human liver was screened with LexA-E12 bait in a yeast reporter strain. Of 1 3 106 independent clones screened, 92 clones with a Leu1 LacZ1 phenotype were obtained. The rep-resentative plasmids from each group of positives were retransformed back into yeast to confirm their correct phenotype. Finally, of 14 true positive clones, 5 independent clones were identified as follows: Id1 (5 clones), Id2 (4 clones), Id3 (3 clones), alpha-1-antitrypsin, and 1 clone encoding the unknown sequence. tcf3-serpina1 2 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association A plasmid library representing the fetal human liver was screened with LexA-E12 bait in a yeast reporter strain. Of 1 3 106 independent clones screened, 92 clones with a Leu1 LacZ1 phenotype were obtained. The rep-resentative plasmids from each group of positives were retransformed back into yeast to confirm their correct phenotype. Finally, of 14 true positive clones, 5 independent clones were identified as follows: Id1 (5 clones), Id2 (4 clones), Id3 (3 clones), alpha-1-antitrypsin, and 1 clone encoding the unknown sequence. tcf3-ccndbp1-1 1 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Myc-E12 was coprecipitated with full-length HHM Fig. 4B tcf3-id2-1 1 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Myc-E12 was coprecipitated with full-length HHM as well as positive controls (FLAG-Id2 Fig. 4B myod1-tcf3-1 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Myc-E12 was coprecipitated with full-length HHM as well as positive controls (FLAG-Id2 and FLAG-MyoD), Fig. 4B tcf3-ccndbp1-2 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 45 48 physical association physical association Bacterial-produced GST-E12 (aa 210-360), but not GST alone, was able to bind directly to several variants of the HHM protein that contained the HLH domain (DHHM [1-184], DHHM [150-360], and the full-length HHM [1-360]) Fig. 4D tcf3-id2-2 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Bacterial-produced GST-E12 (aa 210-360), but not GST alone, was able to bind directly to several variants of the HHM protein that contained the HLH domain (DHHM [1-184], DHHM [150-360], and the full-length HHM [1-360]) as well as positive controls (Id2, MyoD, and E12) Fig. 4D tcf3-myod1-1 3 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Bacterial-produced GST-E12 (aa 210-360), but not GST alone, was able to bind directly to several variants of the HHM protein that contained the HLH domain (DHHM [1-184], DHHM [150-360], and the full-length HHM [1-360]) as well as positive controls (Id2, MyoD, and E12) Fig. 4D tcf3-tcf3-1 3 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Bacterial-produced GST-E12 (aa 210-360), but not GST alone, was able to bind directly to several variants of the HHM protein that contained the HLH domain (DHHM [1-184], DHHM [150-360], and the full-length HHM [1-360]) as well as positive controls (Id2, MyoD, and E12) Fig. 4D