IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MAGOH interacts with a novel RNA-binding protein MAGOH interacts with a novel RNA-binding protein Genomics (0888-7543) 2000 Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov 13-Nov-2007: Contacted by JYOTI. A human fetal brain cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov Accepted 2007-NOV-24 by DAVET. A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 davet MAGOH interacts with a novel RNA-binding protein MAGOH interacts with a novel RNA-binding protein Genomics (0888-7543) 2000 Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov 13-Nov-2007: Contacted by JYOTI. A human fetal brain cDNA library was used. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov Accepted 2007-NOV-24 by DAVET. 13-Nov-2007: Contacted by JYOTI. A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 davet MAGOH interacts with a novel RNA-binding protein MAGOH interacts with a novel RNA-binding protein Genomics (0888-7543) 2000 Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov 13-Nov-2007: Contacted by JYOTI. A human fetal brain cDNA library was used. davet in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhao XF., Nowak NJ., Shows TB., Aplan PD. Cancer - Interactions investigated in the context of cancer aplanp@mail.nih.gov Accepted 2007-NOV-24 by DAVET. 13-Nov-2007: Contacted by JYOTI. A human fetal brain cDNA library was used. Genomics (0888-7543) 2000 davet mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI DIP protein P61326 original sequence version: 113 DIP protein P61326 original sequence version: 114 DIP protein P61326 original sequence version: 78 DIP protein P61326 original sequence version: 91 DIP protein P61326 original sequence version: 100 FFAD0B075E045875 rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR 70BBD03CDDFEECFE magoh-rbm8a 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association The interaction between MAGOH and RBM8 was demonstrated by both yeast two-hybrid and GST fusion protein pull-down assays. PREY gene AF127761 magoh-rbm8a-3 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association The interaction between MAGOH and RBM8 was demonstrated by both yeast two-hybrid and GST fusion protein pull-down assays 1 B PREY gene AF127761 rbm8a-magoh 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association The interaction between MAGOH and RBM8 was demonstrated by both yeast two-hybrid and GST fusion protein pull-down assays 1 B PREY gene AF127761 magoh-rbm8a-4 3 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction PREY gene AF127761 The interaction between MAGOH and RBM8 was demonstrated by both yeast two-hybrid and GST fusion protein pull-down assays 1 C