MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Gene (0378-1119) 1999 Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk in vitro In vitro pull down pull down predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. Gene (0378-1119) 1999 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Gene (0378-1119) 1999 Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. Gene (0378-1119) 1999 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Gene (0378-1119) 1999 Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer Assays were carried out in the two-hybrid reporter yeast strain HF7c. 1 michael.schweizer@bbsrc.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. Gene (0378-1119) 1999 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Gene (0378-1119) 1999 Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer Assays were carried out in the two-hybrid reporter yeast strain pJ69-4A. 1 michael.schweizer@bbsrc.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. Gene (0378-1119) 1999 Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Interaction between the two ubiquitously expressed transcription factors NF-Y and Sp1. Gene (0378-1119) 1999 Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk rat-h4iie Rat hepatoma cell line H4IIE h4iie Rat hepatoma cell line H4IIE anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Roder K., Wolf SS., Larkin KJ., Schweizer M. Cancer - Interactions investigated in the context of cancer 1 michael.schweizer@bbsrc.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. Gene (0378-1119) 1999 sp1_human Transcription factor Sp1 SP1 TSFP1 protein protein human Homo sapiens Human MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF DIP protein P08047 original sequence version: 185 DIP protein P08047 original sequence version: 187 DIP protein P08047 original sequence version: 181 DIP protein P08047 original sequence version: 162 DIP protein P08047 original sequence version: 161 43893DBF6518B9EA nfya_rat Nuclear transcription factor Y subunit alpha Nuclear transcription factor Y subunit A CAAT box DNA-binding protein subunit A Nfya CCAAT-binding transcription factor subunit A protein protein rat Rattus norvegicus (Rat) Rat MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS 3332DB595D67B3A8 sp1_rat Transcription factor Sp1 Sp1 protein protein rat Rattus norvegicus (Rat) Rat MSDQDHSMDEVTAVKIEKGVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESGSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTSQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGAQLGLHGPGGDGIHDETAGGEEGENSPDPQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF 3DE2AD93F95E7C0B nfya_mouse Nuclear transcription factor Y subunit alpha Nuclear transcription factor Y subunit A CAAT box DNA-binding protein subunit A Nfya protein protein mouse Mus musculus Mouse MEQYTTNSNSSTEQIVVQAGQIQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS 1291AA0D3AA76E05 nfya-sp1-1 2 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association nfya-sp1-2 3 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association nfya-sp1-3 3 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-4 3 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-5 3 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association nfya-sp1-6 3 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-7 3 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association nfya-sp1-8 4 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association nfya-sp1-9 4 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association sp1-nfya-1 4 6 unspecified role unspecified role bait bait in vitro In vitro 9 unspecified role unspecified role prey prey in vitro In vitro physical association physical association nfya-sp1-10 4 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-11 4 9 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro physical association physical association nfya-sp1-12 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association nfya-sp1-13 4 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-14 4 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-15 4 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-16 4 9 unspecified role unspecified role bait bait in vitro In vitro 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association nfya-sp1-17 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait in vitro In vitro physical association physical association sp1-sp1-1 1 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association sp1-nfya-2 1 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association sp1-nfya-3 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association nfya-sp1-18 5 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association