IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. J. Biol. Chem. (0021-9258) 2006 imex curation Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu 24-JAN-2007: Contacted by JYOTI. Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation gbrl1_human Gamma-aminobutyric acid receptor-associated protein-like 1 GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1 Early estrogen-regulated protein GABARAPL1 GEC1 protein protein human Homo sapiens Human MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK DIP protein Q9H0R8 original sequence version: 129 7F56E345255F564B oprk_rat Kappa-type opioid receptor Oprk1 Ror-d protein protein rat Rattus norvegicus (Rat) Rat MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRVRNTVQDPASMRDVGGMNKPV 107FEEDB09886F92 nsf_crigr Vesicle-fusing ATPase NSF N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD DIP protein P18708 original sequence version: 120 DIP protein P18708 original sequence version: 101 DIP protein P18708 original sequence version: 121 F3E0CEB2CF1BD582 nsf_rat Vesicle-fusing ATPase Nsf Erg1 N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein rat Rattus norvegicus (Rat) Rat MAGRTMQAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALMREEGASPLDFD 82978187FC3E0E03 gbrap_rat Gamma-aminobutyric acid receptor-associated protein Gabarap GABA(A) receptor-associated protein protein protein rat Rattus norvegicus (Rat) Rat MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL BC0B84B8A51C1E32 gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL DIP protein O95166 original sequence version: 109 DIP protein O95166 original sequence version: 112 DIP protein O95166 original sequence version: 128 DIP protein O95166 original sequence version: 132 BC0B84B8A51C1E32 oprk_human Kappa-type opioid receptor OPRK1 OPRK protein protein human Homo sapiens Human MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV 3DA6E9F90FB48825 oprk1-gec1 2 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925048]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 118-118, sequence length 117 [EBI-925048]39-118 13 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925045]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 381-381, sequence length 380 [EBI-925045]335-381 physical association physical association gec1-oprk1 3 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925067]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 118-118, sequence length 117 [EBI-925067]39-118 physical association physical association gec1-oprk1-1 3 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925082]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 118-118, sequence length 117 [EBI-925082]39-118 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925085]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 381-381, sequence length 380 [EBI-925085]335-381 physical association physical association gec1-oprk1-2 3 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925094]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 381-381, sequence length 380 [EBI-925094]335-381 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925097]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 118-118, sequence length 117 [EBI-925097]39-118 physical association physical association oprk1-gec1-1 5 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association oprk1-gec1-2 4 7 unspecified role unspecified role prey prey n terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-925152]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 381-381, sequence length 380 [EBI-925152]335-381 ecoli Escherichia coli (strain K12) direct interaction direct interaction gec1-oprk1-3 6 13 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association gec1-nsf 6 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association gec1-nsf-1 1 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association