IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli. Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli. J. Biol. Chem. (0021-9258) 2006 imex curation Watanabe S., Matsuyama S., Tokuda H. BioCreative - Critical Assessment of Information Extraction systems in Biology Presence of radio-labelled protein demonstrated by fluorography following SDS-PAGE htokuda@iam.u-tokyo.ac.jp 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Watanabe S., Matsuyama S., Tokuda H. BioCreative - Critical Assessment of Information Extraction systems in Biology Presence of radio-labelled protein demonstrated by fluorography following SDS-PAGE htokuda@iam.u-tokyo.ac.jp Accepted 2006-SEP-12 by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation lpp_ecoli Major outer membrane lipoprotein Lpp lpp mlpA mulI b1677 JW1667 Braun lipoprotein Murein-lipoprotein protein protein ecoli Escherichia coli (strain K12) MKATKLVLGAVILGSTLLAGCSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK DIP protein P69776 original sequence version: 52 19F41D5251913C93 lola_ecoli Outer-membrane lipoprotein carrier protein yzzV P20 lolA lplA b0891 JW0874 protein protein ecoli Escherichia coli (strain K12) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK DIP protein P61316 original sequence version: 77 F2884D82D8DFEF1D lola-lpp-1 1 3 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P61316:p.Ile114Gly mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I G Wed May 02 15:30:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile114gly' Tue Jun 30 19:47:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile114Gly' 2 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P69776:p.Leu30Pro mutation mutation certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:54:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu30pro' Tue Jun 30 19:56:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu30Pro' physical association physical association Effect of LolA mutant assessed using a His-tagged competitor protein L10P is a derivative of Lpp and possesses Pro in place of Leu at position 10. L10P has been shown to be suitable for release assays because the derivative remained release-competent for a long time after its synthesis. L10P co-eluted with LolA proteins adsorbed to a FLAG tag affinity column (F), 6