IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions in vitro In vitro peptide array peptide array antibody detection identification by antibody antibody detection He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions rat-kidney Rat kidney kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins. J. Biol. Chem. (0021-9258) 2006 imex curation He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu 24-JAN-2007: Contacted by JYOTI. dave Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He J., Bellini M., Inuzuka H., Xu J., Xiong Y., Yang X., Castleberry AM., Hall RA. BioCreative - Critical Assessment of Information Extraction systems in Biology Gridded nylon membranes were spotted with PDZ domain fusion proteins. Membranes were overlaid with GST-fusion proteins and interactions visualised using anti-GST antibodies rhall@pharm.emory.edu Accepted 2006-SEP-15 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 dave Only protein-protein interactions imex curation gopc_human Golgi-associated PDZ and coiled-coil motif-containing protein CAL FIG GOPC PDZ protein interacting specifically with TC10 CFTR-associated ligand Fused in glioblastoma protein protein human Homo sapiens Human MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVHDQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY 8A19DDC376DCD0F4 magi2_human Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 MAGI2 KIAA0705 ACVRINP1 Membrane-associated guanylate kinase inverted 2 Atrophin-1-interacting protein 1 Atrophin-1-interacting protein A AIP1 protein protein human Homo sapiens Human MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYEDNYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERPVVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEEPDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFPPALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDDGLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASPQRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRREGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSDKLPSVLKPGASAASR 93E170D070A70A9C magi1_human Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 MAGI1 BAIAP1 BAP1 TNRC19 BAI1-associated protein 1 Membrane-associated guanylate kinase inverted 1 Atrophin-1-interacting protein 3 WW domain-containing protein 3 Trinucleotide repeat-containing gene 19 protein AIP3 protein protein human Homo sapiens Human MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRFQKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQQTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVRAGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAPEGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGRSSRHPPEQRRRPYKECSTDLSI 4B2EE05243A6FA65 magi3_rat Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 Membrane-associated guanylate kinase inverted 3 Scaffolding-like protein Magi3 Slipr protein protein rat Rattus norvegicus (Rat) Rat MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEPGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLITIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSMETREMHSESSDCWMKTVPSYNQTNRSMDFRNYMMRDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDHLNQKTQFENPVEEAKRKKQIGQAETHSAKTDVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKMAPGDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYALPDDSEDPVVDIVAATPVINGQSLAKGEACMSTQDFKLGAMVLDQNGKSGKLLSSDRLNGPSDSNEQRASLASSGSSQPELVTIPLVKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPCSPTKTAKMKTDTKETSGSLETINEPTPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDESPQAFSQSGSPRLNRTELPTRSAPQESYDVILQRKENEGFGFVILTSKSKPPPGVIPHKIGRVIDGSPADRCGRLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHRPMGQAQATHIPGDRTALEGEVGKDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHSQSLGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDIYSPSSSNVIYDEQPPPLPSSHSAATFEESHVPVTEDSLIRVQTCEKAEELKDTVQEKKSTLNGSQPEMKYQSIQKNVSKKDPSRSHGHGDKNLLKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLRSDPKGKSRDRSLSPRKGENKGQVTIKAGSGQDPCRKDRGRSSSPRKQQKIGGNSLSNTEGKLSEAGSRRAAGLSSDSPEQLPEGKEKSGVSRKDLKLSQLGKNRTRSPEKRSSKVDEASLPSKKTSDTASRVVSEKEKGRKPGTGERSRDKTGESVQTSAKPLTQEAGEKMALSKASEVTDRGKERAGGAPESSSPVKKAPITPGPWRVPRANKVTGTAGMADKQL 70E2AFFCE5EA8480 magi3_human Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 MAGI3 KIAA1634 Membrane-associated guanylate kinase inverted 3 protein protein human Homo sapiens Human MSKTLKKKKHWLSKVQECAVSWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDAESQRKRTTSVSKMERMDSSLPEEEEDEDKEAINGSGNAENRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDETLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDHLNQKTQFENPVEEAKRKKQLGQVEIGSSKPDMEKSHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNPQDFKPGAMVLEQNGKSGHTLTGDGLNGPSDASEQRVSMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSPTKTAKMKTDKKENAGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSSQAFISTQNGSPRLNRAEVPARPAPQEPYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDINNPSSSNVIYDEQSPLPPSSHFASIFEESHVPVIEESLRVQICEKAEELKDIVPEKKSTLNENQPEIKHQSLLQKNVSKRDPPSSHGHSNKKNLLKVENGVTRRGRSVSPKKPASQHSEEHLDKIPSPLKNNPKRRPRDQSLSPSKGENKSCQVSTRAGSGQDQCRKSRGRSASPKKQQKIEGSKAPSNAEAKLLEGKSRRIAGYTGSNAEQIPDGKEKSDVIRKDAKQNQLEKSRTRSPEKKIKRMVEKSLPSKMTNKTTSKEVSENEKGKKVTTGETSSSNDKIGENVQLSEKRLKQEPEEKVVSNKTEDHKGKELEAADKNKETGRFKPESSSPVKKTLITPGPWKVPSGNKVTGTIGMAEKRQ 9C2B604D9B1B1B97 dlg1_rat Disks large homolog 1 Dlg1 Synapse-associated protein 97 Dlgh1 protein protein rat Rattus norvegicus (Rat) Rat MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSERISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALPVPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL DIP protein Q62696 original sequence version: 129 DIP protein Q62696 original sequence version: 155 18CEBD31DD0CAF8B dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL DIP protein P31016 original sequence version: 86 DIP protein P31016-1 original sequence version: 148 7922D4E8E0F9AD85 adrb1_rat Beta-1 adrenergic receptor Beta-1 adrenoreceptor Adrb1 Adrb1r protein protein rat Rattus norvegicus (Rat) Rat MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAGMGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDDDDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV DIP protein P18090 original sequence version: 111 2955CB024944A12B gipc1_rat PDZ domain-containing protein GIPC1 RGS19-interacting protein 1 GAIP C-terminus-interacting protein RGS-GAIP-interacting protein GLUT1 C-terminal-binding protein Gipc1 Gipc Rgs19ip1 Synectin protein protein rat Rattus norvegicus (Rat) Rat MPLGLGRRKKAPPLVENEEAEPSRSGLGVGEPGPLGGSGAGESQMGLPPPPASLRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPAAEVMFCTLNTHKVDMDKLLGGQIGLEDFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIQLISVGDMIEAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSSGGHPGSGPQLGTGRGTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDELAEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY 2DE14E6839A218D6 adrb1_human Beta-1 adrenergic receptor Beta-1 adrenoreceptor ADRB1 ADRB1R B1AR protein protein human Homo sapiens Human MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV DIP protein P08588 original sequence version: 119 DIP protein P08588 original sequence version: 133 0950F2684E4721B8 magi1-adrb1-1 4 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ww region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 21 24 direct interaction direct interaction The MAGI1 construct is described by the authors as containng a PDZ domain. From the cordinates of the consruct it appears to be a WW domain. 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. magi2-adrb1-2 4 10 unspecified role unspecified role bait bait s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 32 29 direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. magi2-adrb1-1 4 10 unspecified role unspecified role bait bait s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 37 39 direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. magi3-adrb1-1 4 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 45 42 direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. dlg4-adrb1-1 4 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. gopc-adrb1-1 4 9 unspecified role unspecified role bait bait s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. dlg1-adrb1-1 4 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 67 63 direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. gipc1-adrb1-2 4 17 unspecified role unspecified role bait bait pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 74 70 direct interaction direct interaction 1 To gain a panoramic view of beta1-adrenergic receptor (beta AR) interactions with PDZ scaffolds, the beta1AR carboxyl terminus was screened against a newly developed proteomic array of PDZ domains. magi3-adrb1-2 6 13 unspecified role unspecified role bait bait pdz region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain s-tagged region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P08588:p.Val477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:59:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477ala' Tue Jun 30 17:56:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Ala' P08588:p.Ser475Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:37:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser475ala' Tue Jun 30 20:25:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser475Ala' P08588:p.Glu474Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:44:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu474ala' Tue Jun 30 17:31:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu474Ala' P08588:p.Lys476Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:57:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys476arg' Tue Jun 30 17:36:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys476Arg' P08588:p.Glu474Thr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E T Wed May 02 16:21:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu474thr' Tue Jun 30 20:03:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu474Thr' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A The binding of MAGI-3 PDZ1 to various point-mutated versions of beta1-AR-CT was examined in overlay experiments (Fig. 2A, lanes 1-6). magi3-adrb1-3 1 13 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P08588:p.Val477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 18:47:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477ala' Tue Jun 30 17:01:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Ala' physical association physical association 3A Cellular association of full-length MAGI-3 and full-length beta1AR. magi3-adrb1-4 8 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 3B Beta1AR and MAGI-3 interact in native tissues. magi3-adrb1-5 3 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 3B Beta1AR and MAGI-3 interact in native tissues. magi3-adrb1-6 7 16 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 3B Beta1AR and MAGI-3 interact in native tissues. magi3-adrb1-7 2 13 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 18 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P08588:p.Val477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 15:21:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477ala' Tue Jun 30 18:18:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Ala' P08588:p.Val477Ile mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V I Wed May 02 20:21:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477ile' Tue Jun 30 15:35:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Ile' P08588:p.Val477Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V M Wed May 02 17:27:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477met' Tue Jun 30 17:44:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Met' P08588:p.Val477Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V L Wed May 02 17:02:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477leu' Tue Jun 30 15:40:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Leu' ecoli Escherichia coli (strain K12) physical association physical association 2B To examine the binding of beta1-AR-CT to full length MAGI-3 rather than simply the isolated PDZ1 domain, HEK-293 cells were transfected with full-length V5/His-tagged MAGI-3, and pull-down assays were performed using purified GST fusion proteins corresponding to beta1-AR-CT with the terminal Val residue mutated to either Ala, Ile, Met, or Leu (Fig. 2B). magi3-adrb1-8 5 18 unspecified role unspecified role neutral component neutral component P08588:p.Val477Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:41:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val477ala' Tue Jun 30 17:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val477Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 3A Cellular association of full-length MAGI-3 and full-length beta1AR.