IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. J. Biol. Chem. (0021-9258) 2006 imex curation Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-aorta Homo sapiens aorta electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy antibody detection identification by antibody antibody detection Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Human aortic smooth muscle cells were used in this study. Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca Accepted 2006-SEP-12 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. J. Biol. Chem. (0021-9258) 2006 imex curation Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-cls Homo sapiens fibroblast cell line (GM03318) cls Human fibroblast obtained from patients with Coffin-Lowry Syndrome (CLS). GM03318 (NIGMS Human Genetic Cell Repository) Catalog ID GM03318 (NIGMS Human Genetic Cell Repository) affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca Accepted 2006-SEP-12 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. Lysosomal sialidase (neuraminidase-1) is targeted to the cell surface in a multiprotein complex that facilitates elastic fiber assembly. J. Biol. Chem. (0021-9258) 2006 imex curation Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-aorta Homo sapiens aorta confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Hinek A., Pshezhetsky AV., von Itzstein M., Starcher B. BioCreative - Critical Assessment of Information Extraction systems in Biology Human aortic smooth muscle cells were used in this study. Multi protein complex was isolated by elastin fixed to Affi-gel 10 using affinity chromatography. alek.hinek@sickkids.ca Accepted 2006-SEP-12 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation bgal_human Beta-galactosidase ELNR1 Acid beta-galactosidase Elastin receptor 1 GLB1 protein protein human Homo sapiens Human MPGFLVRILPLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV 74421586B1BCFECA eln_bovin Elastin Tropoelastin ELN protein protein bovin Bos taurus (Bovine) Bovine MRSLTAAARRPEVLLLLLCILQPSQPGGVPGAVPGGVPGGVFFPGAGLGGLGVGGLGPGVKPAKPGVGGLVGPGLGAEGSALPGAFPGGFFGAGGGAAGAAAAYKAAAKAGAAGLGVGGIGGVGGLGVSTGAVVPQLGAGVGAGVKPGKVPGVGLPGVYPGGVLPGAGARFPGIGVLPGVPTGAGVKPKAQVGAGAFAGIPGVGPFGGQQPGLPLGYPIKAPKLPAGYGLPYKTGKLPYGFGPGGVAGSAGKAGYPTGTGVGPQAAAAAAKAAAKLGAGGAGVLPGVGVGGPGIPGAPGAIPGIGGIAGVGAPDAAAAAAAAAKAAKFGAAGGLPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGALSPAATAKAAAKAAKFGARGAVGIGGIPTFGLGPGGFPGIGDAAAAPAAAAAKAAKIGAGGVGALGGVVPGAPGAIPGLPGVGGVPGVGIPAAAAAKAAAKAAQFGLGPGVGVAPGVGVVPGVGVVPGVGVAPGIGLGPGGVIGAGVPAAAKSAAKAAAKAQFRAAAGLPAGVPGLGVGAGVPGLGVGAGVPGLGVGAGVPGPGAVPGTLAAAKAAKFGPGGVGALGGVGDLGGAGIPGGVAGVVPAAAAAAKAAAKAAQFGLGGVGGLGVGGLGAVPGAVGLGGVSPAAAAKAAKFGAAGLGGVLGAGQPFPIGGGAGGLGVGGKPPKPFGGALGALGFPGGACLGKSCGRKRK DIP protein P04985 original sequence version: 95 633C03E411643D83 neur1_human Sialidase-1 Lysosomal sialidase N-acetyl-alpha-neuraminidase 1 Acetylneuraminyl hydrolase G9 sialidase NEU1 NANH protein protein human Homo sapiens Human MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL 360E60A256DEA07F ppgb_human Lysosomal protective protein Cathepsin A Carboxypeptidase C Protective protein for beta-galactosidase CTSA PPGB Carboxypeptidase L Protective protein cathepsin A protein protein human Homo sapiens Human MIRAAPPPLFLLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY 46B737DEE775C508 eln-glb1 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey association association Figure 1A The 67-kDa Spliced Variant of -Galactosidase That Binds Elastin Also Forms a Cell Membrane-targeted Complex with Neu1 and PPCA From the reference given in the paper the identity of the elastin protein was deteremined as P04985. eln-neu1 3 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 2C confocal microscopy demonstrated that polyclonal antibody to lysosomal Neu1 and monoclonal antibody raised against EBP co-localized on the surface of nonfixed ASMCs. The proteins colocalised to the surface of non-fixed human aortic smooth muscle cells. eln-neu1-1 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization Figure 3D The representative electron micrograph of double immunogold labeling demonstrates co-localization of Neu1 and EBP on the cell surface of ASMCs Proteins colocalised to the cell surface of aortic smooth muscle cells.