IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. J. Biol. Chem. (0021-9258) 2006 imex curation Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation 3, 4 manfiole@units.it 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology A series of HMG proteins or deletion constructs obtained from HEK 293 cells were run on the gel and blot overlay was performed with cell lysates obtained from HEK293 cells expressing HA tagged PRMT6 or NPM constructs. These were then visualised with anti HA antibodies. 3, 4 manfiole@units.it Accepted 2006-MAY-19 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. J. Biol. Chem. (0021-9258) 2006 imex curation Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation 3, 4 manfiole@units.it 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as ms participant Identification by mass spectrometry ms participant Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it Accepted 2006-MAY-19 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. J. Biol. Chem. (0021-9258) 2006 imex curation Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation 3, 4 manfiole@units.it 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it Accepted 2006-MAY-19 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. The AT-hook of the chromatin architectural transcription factor high mobility group A1a is arginine-methylated by protein arginine methyltransferase 6. J. Biol. Chem. (0021-9258) 2006 imex curation Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology Chromatin - Epigenetic interactions resulting in chromatin modulation 3, 4 manfiole@units.it 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro radiolabeled methyl methyltransferase radiometric assay radiolabeled methyl predetermined predetermined participant predetermined Sgarra R., Lee J., Tessari MA., Altamura S., Spolaore B., Giancotti V., Bedford MT., Manfioletti G. BioCreative - Critical Assessment of Information Extraction systems in Biology 3, 4 manfiole@units.it Accepted 2006-MAY-19 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation anm6_human Protein arginine N-methyltransferase 6 Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 PRMT6 HRMT1L6 Histone-arginine N-methyltransferase PRMT6 protein protein human Homo sapiens Human MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED 40AAEC7342C08A38 p17095-1 High mobility group protein HMG-I/HMG-Y HMGA1b HMGI-E Hmga1 Hmgi Hmgiy High mobility group AT-hook protein 1 protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ A77A3FD7CA6C08EC anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR DIP protein Q99873 original sequence version: 87 DIP protein Q99873 original sequence version: 125 544349801B0E1396 p17095-2 High mobility group protein HMG-I/HMG-Y HMGA1a Hmga1 Hmgi Hmgiy High mobility group AT-hook protein 1 protein protein mouse Mus musculus Mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ 4EC39386611959FC s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hmga2_human High mobility group protein HMGI-C High mobility group AT-hook protein 2 HMGA2 HMGIC protein protein human Homo sapiens Human MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED F36BABE623DA4615 hmga2_mouse High mobility group protein HMGI-C High mobility group AT-hook protein 2 Hmga2 Hmgic protein protein mouse Mus musculus Mouse MSARGEGAGQPSTSAQGQPAAPVPQKRGRGRPRKQQQEPTCEPSPKRPRGRPKGSKNKSPSKAAQKKAETIGEKRPRGRPRKWPQQVVQKKPAQETEETSSQESAEED 40A3E38F62268C09 p17096-2 High mobility group protein HMG-I/HMG-Y HMGA1b HMGA1 HMGIY High mobility group AT-hook protein 1 High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ Contains a phosphothreonine at position 67. Contains a phosphothreonine at position 42. B82DCAA29E6D18FD p17096-1 High mobility group protein HMG-I/HMG-Y HMGA1a HMGA1 HMGIY High mobility group AT-hook protein 1 High mobility group protein R protein protein human Homo sapiens Human MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ E9C4E3F2200914B8 hrmt1l6-hmgiy 3 13 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association hrmt1l6-hmgiy-1 1 13 unspecified role unspecified role bait bait at hook 2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Hek293 Cell lysates and various deletion mutants were used to obtain the results. hrmt1l6-hmgiy-2 1 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 unspecified role unspecified role bait bait physical association physical association HEK 293 lysates were used for WT HMGA1b interaction hrmt1l6-hmga2 1 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association HEK 293 lysates were used for WT HMGA2 interaction hrmt1l2-hmga2 4 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction performed in the presence of H3 labelled SAM CHEBI:15414 hrmt1l2-hmga2-1 4 11 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 7 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction performed in the presence of H3 labelled SAM CHEBI:15414 hrmt1l6-hmgiy-3 4 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-4 4 6 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-5 4 13 enzyme target enzyme target substrate substrate unspecified role unspecified role P17096-1:p.[Arg58Ala;Arg60Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:06:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg58ala,arg60ala' Tue Jun 30 19:35:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg58Ala;Arg60Ala]' at hook 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmg2a 4 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmg2a-1 4 11 enzyme target enzyme target substrate substrate unspecified role unspecified role 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 hrmt1l6-hmgiy-6 2 5 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) 13 enzyme target enzyme target substrate substrate unspecified role unspecified role at hook 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role ancillary ancillary physical association physical association Interaction carried out in the presence of H3 Labelled SAM CHEBI:15414 Time course of methyltransferase activity indicates the presence of monomethylarginines within 4 hours and dimethylarginine over 32 hours. Mehtylation occurs on R57 and R59 of HMGI/Y.