IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. J. Biol. Chem. (0021-9258) 2006 imex curation Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. Accepted 2006-SEP-1 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. J. Biol. Chem. (0021-9258) 2006 imex curation Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. Accepted 2006-SEP-1 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. J. Biol. Chem. (0021-9258) 2006 imex curation Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. Accepted 2006-SEP-1 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity. J. Biol. Chem. (0021-9258) 2006 imex curation Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Choi HJ., Huber AH., Weis WI. Apoptosis - Interactions involving proteins with a function related to apoptosis ITC measurements were performed at 30 �C using a VP-ITC calorimeter (Microcal, Inc.). Experiments carried out in H buffer (25 mM HEPES,pH7.5, buffer containing 75 mm NaCl and 0.5 mM EDTA). bill.weis@stanford.edu. Accepted 2006-SEP-1 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD DIP protein O15169 original sequence version: 118 DIP protein O15169 original sequence version: 125 DIP protein O15169-1 original sequence version: 140 DIP protein O15169 original sequence version: 132 10779173F5092F3F cadh1_mouse Cadherin-1 Epithelial cadherin Uvomorulin ARC-1 Cdh1 protein protein mouse Mus musculus Mouse MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFEGCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKSMGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVNDPDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPETGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDLEIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGILALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD DIP protein P09803 original sequence version: 92 DIP protein P09803 original sequence version: 116 DIP protein P09803 original sequence version: 124 DIP protein P09803 original sequence version: 128 DIP protein P09803 original sequence version: 141 DIP protein P09803 original sequence version: 174 7A6444148D3D5983 ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein Q02248 original sequence version: 128 DIP protein Q02248 original sequence version: 135 DIP protein Q02248 original sequence version: 147 DIP protein Q02248 original sequence version: 187 DIP protein Q02248 original sequence version: 140 D708F170A3FBED6E apc_human Adenomatous polyposis coli protein APC DP2.5 Deleted in polyposis 2.5 protein protein human Homo sapiens Human MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKGLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV DIP protein P25054 original sequence version: 143 DIP protein P25054-1 original sequence version: 157 DIP protein P25054 original sequence version: 158 77E194AE4A91DC5A lef1_mouse Lymphoid enhancer-binding factor 1 Lef1 Lef-1 protein protein mouse Mus musculus Mouse MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI DIP protein P27782 original sequence version: 88 DIP protein P27782-1 original sequence version: 103 0CA01B6C528FD7FA cnbp1_human Beta-catenin-interacting protein 1 Inhibitor of beta-catenin and Tcf-4 CTNNBIP1 ICAT protein protein human Homo sapiens Human MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ 3DA6CF90B50CE942 ctnnb1-cdh1 3 7 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. KD 3.6 (plus or minus 4.4) E-8 M DeltaH (kcal per M) -35.9 plus or minus 0.4; TDeltaS (kcal per mol) -25.6; DeltaG (kcal/mol) -10.3 ctnnb1-cdh1-1 1 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component region Phosphorylated cytoplasmic domain (serines phosphorylated) opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. PhosphoEcyto is an exceptionally avid ligand, with a KD of 52 pM. KD 5.2 (plus or minus 5.0) E-11 M DeltaH (kcal per M) -53.5 plus or minus 1.6; TDeltaS (kcal per mol) -39.2; DeltaG (kcal/mol) -14.3 ctnnb1-lef1 3 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. KD 4.9 (plus or minus 3.6) E-8 M DeltaH (kcal per M) -14.7 plus or minus 0.1; TDeltaS (kcal per mol) -4.6; DeltaG (kcal/mol) -10.1 ctnnb1-lef1-1 3 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-131) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. KD 2.0 (plus or minus 6.6) E-8 M DeltaH (kcal per M) -16.7 plus or minus 0.2; TDeltaS (kcal per mol) -6.0; DeltaG (kcal/mol) -10.7 ctnnb1-ctnnbip1 3 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. Kd 3.1 (plus or minus 1.0) E-9 M DeltaH (kcal per M) -19.8 plus or minus 0.1; TDeltaS (kcal per mol) -8.0; DeltaG (kcal/mol) -11.8 ctnnb1-ctnnbip1-1 3 10 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. Kd 1.2 (plus or minus 1.0) E-8 M DeltaH (kcal per M) -12.5 plus or minus 0.1; TDeltaS (kcal per mol) -1.5; DeltaG (kcal/mol) -11.0 ctnnb1-apc 3 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range KD 3.1 (plus or minus 0.3) E-6 M DeltaH (kcal per M) -4.5 plus or minus 0.1; TDeltaS (kcal per mol) 3.1; DeltaG (kcal/mol) -7.6 ctnnb1-apc-1 3 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region PhosphoAPC-R3 (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. KD 1.0 (plus or minus 1.3) E-8 M DeltaH (kcal per M) -31.2 plus or minus 0.2; TDeltaS (kcal per mol) -20.1; DeltaG (kcal/mol) -11.1 ctnnb1-axin1 3 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range KD 1.3 (plus or minus 0.2) E-6 M DeltaH (kcal per M) -6.9 plus or minus 0.2; TDeltaS (kcal per mol) 1.3; DeltaG (kcal/mol) -8.2 ctnnb1-cdh1-2 1 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 and Table 1 The affinities of -catenin ligands vary over a wide range (Table 1) and can be classified into three groups. APC-R3 and axin belong to the low affinity group with dissociation constants in the single micromolar range, whereas Ecyto, Lef-1-(1�61), Lef-1-(1�131), phosphoAPC, ICAT, and ICAT-h have KD values in the range of tens of nanomolar. KD 4.6 (plus or minus 4.4) E-8 M; 4.6 (plus or minus 2.2) E-8 M in a second assay DeltaH (kcal per M) -39.2 plus or minus 0.2; TDeltaS (kcal per mol) -29.0; DeltaG (kcal/mol) -10.2 ctnnb1-cdh1-3 4 6 unspecified role unspecified role bait bait n-terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 5 A and C, Table 3 Fitting of surface plasmon resonance data for Ecyto and phosphoEcyto binding to -catenin Fitting model 1:1 ka1 3.56 E5 per M per s; kd 6.49 E-3 per s; Fitting model heteroligand ka1 4.39 %5 per M per s; kd 5.15 E-3; ka2 1.11 E5 per s; kd2 1.41 E-2 per s. Fitting the data with simple 1:1 binding models (Table 3) gave KD values which are very close to the values obtained by ITC. The good agreement in the KD values indicates that although the 1:1 models do not give particularly good fits to the data (probably reflecting more complicated kinetic processes associated with the structuring of cadherin upon binding to beta-catenin), they are nonetheless reasonable approximations. The fitted rate constants show that phosphorylation increases the on rate approx. 13-fold and decreases the off rate approx. 18-fold. Better fits to the nonphosphorylated data were obtained using a model in which there are two distinct molecular species of E-cadherin on the chip (�heterogeneous ligand� model). ctnnb1-cdh1-4 4 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component region Phosphorylated cytoplasmic domain (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 5 B, Table 3 Fitting of surface plasmon resonance data for Ecyto and phosphoEcyto binding to -catenin Fitting model 1:1 Ka1 4.49 E6 per M per s; kd 3.67 E-4 per s ctnnb1-cdh1-5 1 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 7.4 (plus or minus 3.8) E-8 M DeltaH (kcal per mol) -41.1 plus or minus 0.3; TDeltaS (kcal per mol) -31.2; DeltaG (kcal per mol) -9.9 ctnnb1-cdh1-6 1 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 5.8 (plus or minus 4.3) E-8 M DeltaH (kcal per mol) -36.5 plus or minus 0.6; TDeltaS (kcal per mol) -26.5; DeltaG (kcal per mol) -10.0 ctnnb1-cdh1-7 2 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 8.3 (plus or minus 2.5) E-8 M DeltaH (kcal per mol) -39.5 plus or minus 0.2; TDeltaS (kcal per mol) -29.7 plus or minus 0.5; DeltaG (kcal/mol) -9.8 plus or minus 0.1 ctnnb1-cdh1-8 2 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 9.3 (plus or minus 4.0) E-8 M DeltaH (kcal per mol) -39.7 plus or minus 0.5; TDeltaS (kcal per mol) -30.0 plus or minus 3.0; DeltaG (kcal/mol) -9.7 plus or minus 0.1 ctnnb1-cdh1-9 2 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 1.13 (plus or minus 5.1) E-7 M DeltaH (kcal per mol) -43.3 plus or minus 0.4; TDeltaS (kcal per mol) -33.7; DeltaG (kcal/mol) -9.6 ctnnb1-cdh1-10 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role neutral component neutral component region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 4 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 6.0 (plus or minus 2.3) E-8 M DeltaH (kcal per mol) -34.8 plus or minus 0.2; TDeltaS (kcal per mol) -24.8; DeltaG (kcal/mol) -10.0 ctnnb1-lef1-2 2 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 5 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. Kd 5.0 (plus or minus 2.1) E-8 M DeltaH (kcal per M) -11.9 plus or minus 0.1; TDeltaS (kcal per mol) -1.8 plus or minus 0.2; DeltaG (kcal/mol) -10.1 plus or minus 0.1 ctnnb1-lef1-3 2 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 5 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 3.7 (plus or minus 1.7) E-8 M DeltaH (kcal per M) -16.1 plus or minus 0.1; TDeltaS (kcal per mol) -5.8; DeltaG (kcal/mol) -10.3 ctnnb1-lef1-4 2 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 5 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 2.8 (plus or minus 1.3) E-8 M DeltaH (kcal per M) -15.1 plus or minus 0.1; TDeltaS (kcal per mol) -4.6 plus or minus 1.0; DeltaG (kcal/mol) -10.5 plus or minus 0.1 ctnnb1-lef1-5 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 9 unspecified role unspecified role neutral component neutral component n-terminal Lef-1(1-65) binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 5 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 4.3 (plus or minus 2.4) E-8 M DeltaH (kcal per M) -10.5 plus or minus 0.1; TDeltaS (kcal per mol) -0.3 plus or minus 1.1; DeltaG (kcal/mol) -10.2 plus or minus 0.2 ctnnb1-ctnnbip1-2 2 10 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 6 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 1.0 (plus or minus 2.0) E-8 M DeltaH (kcal per M) -11.5 plus or minus 0.1; TDeltaS (kcal per mol) -0.4; DeltaG (kcal/mol) -11.1 ctnnb1-ctnnbip1-3 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 6 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 8.4 (plus or minus 6.2) E-8 M DeltaH (kcal per M) -10.2 plus or minus 0.1; TDeltaS (kcal per mol) -0.4; DeltaG (kcal/mol) -9.8 ctnnb1-ctnnbip1-4 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 6 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 3.9 (plus or minus 2.3) E-8 M DeltaH (kcal per M) -8.1 plus or minus 0.1; TDeltaS (kcal per mol) 2.2; DeltaG (kcal/mol) -10.3 ctnnb1-ctnnbip1-5 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role neutral component neutral component n-terminal ICAT-h binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 6 The data show that the presence or absence of either or both -catenin tail regions has no significant effect on binding to the strong ligands Ecyto, phosphoAPC, Lef-1, and ICAT-h. KD 6.2 (plus or minus 4.6) E-8 M DeltaH (kcal per M) -10.8 plus or minus 0.1; TDeltaS (kcal per mol) -0.8; DeltaG (kcal/mol) -10.0 ctnnb1-apc-2 2 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 7 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 1.16 (plus or minus 0.7) E-5 M DeltaH (kcal per M) -9.3 plus or minus 0.4; TDeltaS (kcal per mol)-2.4 plus or minus 1.0; DeltaG (kcal/mol) -6.9 plus or minus 0.1 ctnnb1-apc-3 2 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 7 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 1.0 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -23.0 plus or minus 0.2; TDeltaS (kcal per mol) -14.6 plus or minus 0.2; DeltaG (kcal/mol) -8.4 plus or minus 0.1 ctnnb1-apc-4 2 7 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 7 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 4.5 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -19.3 plus or minus 0.4; TDeltaS (kcal per mol) -11.9; DeltaG (kcal/mol) -7.4 ctnnb1-apc-5 2 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 7 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 1.45 (plus or minus 0.8) E-5 M DeltaH (kcal per M) -15.6 plus or minus 0.8; TDeltaS (kcal per mol) -8.9 plus or minus 0.3; DeltaG (kcal/mol) -6.7 plus or minus 0.2 ctnnb1-apc-6 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 8 unspecified role unspecified role neutral component neutral component region APC-R3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region PhosphoAPC-R3 (serines phosphorylated) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 7 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 8.1 (plus or minus 4.9) E-8 M DeltaH (kcal per M) -25.9 plus or minus 0.1; TDeltaS (kcal per mol)-16.1; DeltaG (kcal/mol) -9.8 ctnnb1-axin1-1 2 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 8 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 1.6 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -9.0 plus or minus 0.2; TDeltaS (kcal per mol) -0.9 plus or minus 0.3; DeltaG (kcal/mol) -8.1 plus or minus 0.1 ctnnb1-axin1-2 2 7 unspecified role unspecified role neutral component neutral component region beta-cat-arm binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 8 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 0.3 (plus or minus 0.4) E-6 M DeltaH (kcal per M) -12.0 plus or minus 0.2; TDeltaS (kcal per mol) -3.0; DeltaG (kcal/mol) -9.0 ctnnb1-axin1-3 2 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component n-terminal beta-cat-arm-Nt sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 8 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 0.7 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -9.7 plus or minus 0.3; TDeltaS (kcal per mol) -1.2; DeltaG (kcal/mol) -8.5 ctnnb1-axin1-4 2 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component c-terminal beta-cat-arm-Ct sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 8 Most interestingly, the presence of the C-tail appears to weaken the affinity of axin slightly, at most 7-fold (compare -cat-arm to -cat-arm-Ct), and has a somewhat stronger effect on APC-R3, changing the affinity by up to 20-fold. KD 2.2 (plus or minus 0.1) E-6 M DeltaH (kcal per M) -10.2 plus or minus 0.3; TDeltaS (kcal per mol) -2.3; DeltaG (kcal/mol) -7.9