IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. J. Biol. Chem. (0021-9258) 2006 imex curation Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology D.R.Poyner@aston.ac.uk 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology D.R.Poyner@aston.ac.uk Accepted 2006-JUL-20 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. The second intracellular loop of the calcitonin gene-related peptide receptor provides molecular determinants for signal transduction and cell surface expression. J. Biol. Chem. (0021-9258) 2006 imex curation Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology D.R.Poyner@aston.ac.uk 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Conner AC., Simms J., Howitt SG., Wheatley M., Poyner DR. BioCreative - Critical Assessment of Information Extraction systems in Biology Membranes from cells transfected with HA-tagged CALCRL were homogenized briefly before use, and 500uL were incubated with 100 pM [125I]iodohistidyl8-human alpha CGRP. Presence of CALCRL confirmed by anti-HA Abs. D.R.Poyner@aston.ac.uk Accepted 2006-JUL-20 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation p06881-pro_0000004054 Calcitonin gene-related peptide 1 CALCA CALC1 Alpha-type CGRP Calcitonin gene-related peptide I peptide peptide polypeptide oligopeptide oligopeptide polypeptide human Homo sapiens Human ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF 83 119 F5DDEDA3C7A5F427 calrl_human Calcitonin gene-related peptide type 1 receptor CALCRL CGRPR Calcitonin receptor-like receptor protein protein human Homo sapiens Human MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN DIP protein Q16602 original sequence version: 94 AF98E55E5454767C ramp1_human Receptor activity-modifying protein 1 RAMP1 Calcitonin-receptor-like receptor activity-modifying protein 1 protein protein human Homo sapiens Human MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV DIP protein O60894 original sequence version: 86 8530DD590BAEBE5C calcrl-ramp1-1 1 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Species origin of RAMP1 clone assumed from previous work by this group. When HA-CLR was co-expressed with RAMP1, fluorescence was seen both inside the cell and on the plasma membrane 3b calca-calcrl-1 2 3 unspecified role unspecified role bait bait in vitro In vitro 4 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Addtional detail on alphaCGRP peptide taken from vendors catalogue The total cellular expression of transfected receptors was compared with wild type using radioligand binding analyses. Table 3, Fig. 4