IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. J. Biol. Chem. (0021-9258) 2006 imex curation Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology reedoffice@burnham.org 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Accepted 2006-AUG-24 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. J. Biol. Chem. (0021-9258) 2006 imex curation Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology reedoffice@burnham.org 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Accepted 2006-AUG-24 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. J. Biol. Chem. (0021-9258) 2006 imex curation Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology reedoffice@burnham.org 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Accepted 2006-AUG-24 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. J. Biol. Chem. (0021-9258) 2006 imex curation Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology reedoffice@burnham.org 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis reedoffice@burnham.org Accepted 2006-AUG-24 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. Distinct BIR domains of cIAP1 mediate binding to and ubiquitination of tumor necrosis factor receptor-associated factor 2 and second mitochondrial activator of caspases. J. Biol. Chem. (0021-9258) 2006 imex curation Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology reedoffice@burnham.org 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Samuel T., Welsh K., Lober T., Togo SH., Zapata JM., Reed JC. Apoptosis - Interactions involving proteins with a function related to apoptosis Bait proteins radio-labelled and visualised by radiography reedoffice@burnham.org Accepted 2006-AUG-24 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation birc3_human Baculoviral IAP repeat-containing protein 3 Inhibitor of apoptosis protein 1 TNFR2-TRAF-signaling complex protein 1 IAP homolog C Apoptosis inhibitor 2 RING finger protein 49 BIRC3 API2 MIHC RNF49 RING-type E3 ubiquitin transferase BIRC3 Cellular inhibitor of apoptosis 2 protein protein human Homo sapiens Human MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDLLNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS DIP protein Q13489 original sequence version: 127 8581A00BA9AAB4A7 birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS C1778D328063586D dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 birc2-traf2-1 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir1 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association the BIR1 domain of cIAP1 is necessary and sufficient for interaction with TRAF2. BIRC2 constructs tagged with either Flag or Myc-tags 2A birc2-diablo-1 2 7 unspecified role unspecified role bait bait bir3 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association In contrast, SMAC co-immunoprecipitated with all cIAP1 fragments that contained BIR3 while failing to associate with all cIAP1 fragments lacking BIR3 (Fig. 2A) BIRC2 constructs tagged with either Flag or Myc-tags 2A birc4-diablo-6 2 9 unspecified role unspecified role bait bait bir3 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association However, SMAC did co-immunoprecipitate with full-length XIAP and with all fragments of XIAP containing BIR3. BIRC4 constructs tagged with either Flag or Myc-tags 2B Some indication of weak interaction with Bir2 domain (residues 124-260). birc2-traf2-2 4 7 unspecified role unspecified role bait bait bir1_3 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association First, we used the GST pulldown method to compare the ability of cIAP1, cIAP2, and XIAP to bind TRAF2 in vitro, employing fragments of cIAP1, cIAP2, and XIAP comprised of the three tandem BIR domains and using L-[35S]methioninelabeled TRAF2 prepared by in vitro translation (Fig. 3A). 3A birc3-traf2-1 4 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir1 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association First, we used the GST pulldown method to compare the ability of cIAP1, cIAP2, and XIAP to bind TRAF2 in vitro, employing fragments of cIAP1, cIAP2, and XIAP comprised of the three tandem BIR domains and using L-[35S]methioninelabeled TRAF2 prepared by in vitro translation (Fig. 3A). 3A, 3B, birc2-traf2-3 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey association association FLAGcIAP1 was immunoprecipitated using anti-FLAG antibody, and associated TRAF2 (and SMAC) were detected by immunoblotting. 3C BIRC3 (Q13489) Bir1 domain (residues 1-132)inhibits binding of BIRC2 to TRAF2 but not DIABLO. birc3-traf2-2 3 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait bir1 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association TRAF2 binding to FLAG-cIAP1 (first panel) or GST- cIAP2 BIR1 (second panel) was examined by SDS-PAGE and immunoblotting (IB) with antibodies against TRAF2. Themembranewas also probed with an anti-SMAC antibody 3C birc2-traf2-4 2 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir1 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q13490:p.Glu64delinsAlaArg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E AR Wed May 02 18:16:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu64ala_arg' Tue Jun 30 19:04:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu64delinsAlaArg' Q13490:p.Arg65Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Wed May 02 18:21:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg65glu' Tue Jun 30 18:59:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg65Glu' physical association physical association These mutant BIR1 proteins were then expressed as Myctagged proteins in HEK293T cells and assessed for their ability to bind endogenous TRAF2 present in the cell lysates by co-immunoprecipitation assay. 4D birc3-traf2-3 5 6 unspecified role unspecified role bait bait bir1 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13489:p.Glu47_Arg48delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ER AA Thu Jul 07 12:15:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was glu47ala_arg48ala Fri Jul 22 11:14:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu47ala,arg48ala' Wed May 02 16:30:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_arg47-48ala_ala' Tue Jun 30 19:42:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu47_Arg48delinsAlaAla' ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association To verify that the E64 and R65 mutations directly affect BIR1-TRAF2 association, we used cIAP2 instead of cIAP1, and we produced recombinant single mutant E64R and double mutant E64A/R65A BIR1 proteins in bacteria and examined their interaction with TRAF2 in vitro. 5A Mutants described in Fig. 5A remapped to match sequence. birc2-diablo-2 2 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir3 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q13490:p.Trp316Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:44:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp316ala' Tue Jun 30 17:15:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp316Ala' Q13490:p.Asp320Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 17:14:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp320ala' Tue Jun 30 19:44:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp320Ala' 8 unspecified role unspecified role prey prey physical association physical association For these experiments, wild-type cIAP1 and mutants of cIAP1 were expressed with FLAG tags in HEK293T cells, and their ability to bind mature SMAC protein present within detergent lysates was analyzed by SDS-PAGE/immunoblotting. 3B, 3C & 6A birc2-traf2-5 1 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bir1_3 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q13490:p.Glu64Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 20:14:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu64ala' Tue Jun 30 18:00:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu64Ala' physical association physical association RING mutation does not affect interaction of cIAP1 with TRAF2 or SMAC 7B