IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. J. Biol. Chem. (0021-9258) 2006 imex curation Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu Accepted 2006-JUL-25 by JYOTI. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. An Arabidopsis Fip1 homolog interacts with RNA and provides conceptual links with a number of other polyadenylation factor subunits. J. Biol. Chem. (0021-9258) 2006 imex curation Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Forbes KP., Addepalli B., Hunt AG. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay was used in this study. aghunt00@uky.edu Accepted 2006-JUL-25 by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation fips5_arath FIP1[V]-like protein FIPS5 FIP1[V] Factor interacting with poly(A) polymerase 1-like 5 Protein HOMOLOG OF YEAST FIP1 [V] At5g58040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDDEFGDLYSDVLQPFQPPVVLPPPPPLPHRSIDLNLRSQDQDVSEPNSAPISRVSDNDAVKLSTQDATRQAIVDGGGDDKDMSFDIEEPDADSTPTIPGLFVTGALPGLATDRGVSQVTTRIEQQVGGGGDGGYGGQGEGDDWDSDSEDDLQIVLNDSSRNVMIGGADRRSRMGDNEDDDDEDDEDPLVIVADTDPNQPMEEQMWGEDGLQGIEGDGKDGGEAGKGSGPGGATGPPKAGYSSHGYHPFHSQFKYVRPGAAPIPGGAASVGGPSSGQVRPPANLGPMAGRGRGDWRPLGMRNASAAQKGFHQPWGSNTAGRGLDFTLPSHKTIFEVDIDSFEEKPWRYPGVEMTDYFNFGLNEESWKDYCKQLDQHRIQTTMQSRIRVYESGRTDQGYDPDLPPELAAATGAQGVPVDSSNLVKPDSVQGDSAKVPANVRPTLPPGRPIPVETGSGERLPSIDTRAPRMRDLDAIIEIVCQDSHEDEPSGENGTDQADSSLPGENVPVETSYVNNKRPDTESAEHSPAQDEPHKNLLKKQDDEISRSTDSGQSFRSSSPVGDRGTRSSSVDREDVGGEAGKDAEMGEELKMSFTSPQSAVQEDDGGESKTERSSESSKARSGSHRDFQQEEDVIQDKHSSRPANNRKQYDNNAPHQSRKNQDRGKEMERTRAASKGGRENSNPHMELDSTYIYSIASREDFDKRKERDVDGAVWRRKEDDPYSRRGGDEGSRKRDREDDPGFRQRGKMRENEIRSKDDQVPSRKHMDDAGMRNIYEPDDHINKRRKDEEYLRRSRPEKNEISYGQRESMSRVKRERDDRLEHQKRDVQHKIRDDFDDHGSLRQRDDIYMQRDGNERLRERDVLDKLKLPHEDGISARGRERQVAVRGHRGSEDRSSRMKDEYKASDKEHVTKDTLRHAKQTKRRDYPGEESSSHHRGHEDFSARTDNIVNNEKKPRQERTGAKIDKFIDTLDGQRLQDRKHKDSRRKIKEQREGTESLSKQGEQNGSSVVTGSKGTNDARNCRSEIPHQPNTAKRHKENASSGDEIHDSKRGRTKLERWASHKEREDAVSAKSSSISSKLEEKENNTNGRLSEPVHGSIGKSRDVTEEKIGHDLADTKDGSEKGPGDRHLDTVEKLKKRSERFKLPMPTEKDTTGVKKMESETLPSAKIEGPVDSEGEYVWDERSCVRIGREYA FF928745DF43F32C paps4_arath Nuclear poly(A) polymerase 4 PAPS4 NPAP Polynucleotide adenylyltransferase 4 T16I18.60 At4g32850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMVGTQNLGGSLPPLNSPKSYGITKPLSLAGPSSADIKRNVELEKYLVDEGLYESKDDTMRREEVLGRIDQIVKHWVKQLTQQRGYTDQMVEDANAVIFTFGSYRLGVHGPGADIDTLCVGPSYVNREEDFFIILHDILAEMEEVTELHPVPDAHVPVMKFKFQGIPIDLLYASISLLVVPQDLDISSSSVLCEVDEPTVRSLNGCRVADQILKLVPNFEHFRTTLRCLKYWAKKRGVYSNVTGFLGGVNWALLVARVCQLYPNAIPSMLVSRFFRVYTQWRWPNPVMLCAIEEDELGFPVWDRRKNHRDRYHLMPIITPAYPCMNSSYNVSQSTLRVMTEQFQFGNNILQEIELNKQHWSSLFEQYMFFEAYKNYLQVDIVAADAEDLLAWKGWVESRFRQLTLKIERDTNGMLMCHPQPNEYVDTARQFLHCAFFMGLQRAEGVGGQECQQFDIRGTVDEFRQEVNMYMFWKPGMDVFVSHVRRRQLPPFVFPNGYRRPRQSRHQNLPGGKSGEDGSVSHSGSVVERHAKRKNDSEMMDVRPEKPEKRASLSPQSLDIVSPENSAITTGWTPPVCNLRRPPSEEIEADNLNTECTELTDLARNECNSGSEQVLEVDSMAVVQECSDPAEPLGKCVTPDSVDVVACVSGQEENLDRNLRSVSISGTDSPLLPSRSCGQNRDYEGFGFPAANSDPMGKKNLYSQSGMSEDLQSNSLVSGMEKSEDRARSESFQKSQIRLLT BCA233700431BB6D cpsf_arath 30-kDa cleavage and polyadenylation specificity factor 30 CPSF30 F26G16.6 Zinc finger CCCH domain-containing protein 11 F26G16.5 At1g30460 OXT6 Protein OXIDATIVE STRESS TOLERANT 6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDADGLSFDFEGGLDSGPVQNTASVPVAPPENSSSAAVNVAPTYDHSSATVAGAGRGRSFRQTVCRHWLRGLCMKGDACGFLHQFDKARMPICRFFRLYGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHAKLPGPPPPVEEVLQKIQQLTTYNYGTNRLYQARNVAPQLQDRPQGQVPMQGQPQESGNLQQQQQQQPQQSQHQVSQTLIPNPADQTNRTSHPLPQGVNRYFVVKSNNRENFELSVQQGVWATQRSNEAKLNEAFDSVENVILIFSVNRTRHFQGCAKMTSRIGGYIGGGNWKHEHGTAQYGRNFSVKWLKLCELSFHKTRNLRNPYNENLPVKISRDCQELEPSVGEQLASLLYLEPDSELMAISIAAEAKREEEKAKGVNPESRAENPDIVPFEDNEEEEEEEDESEEEEESMAGGPQGRGRGRGIMWPPQMPLGRGIRPMPGMGGFPLGVMGPGDAFPYGPGGYNGMPDPFGMGPRPFGPYGPRFGGDFRGPVPGMMFPGRPPQQFPHGGYGMMGGGRGPHMGGMGNAPRGGRPMYYPPATSSARPGPSNRKTPERSDERGVSGDQQNQDASHDMEQFEVGNSLRNEESESEDEDEAPRRSRHGEGKKRR 120272CD4142355F cfis1_arath Pre-mRNA cleavage factor Im 25 kDa subunit 1 CFIS1 CFIM25 Cleavage and polyadenylation specificity factor 25 kDa subunit Cleavage and polyadenylation specificity factor subunit 25 F27B13.60 At4g29820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGEEARALDMEEISDNTTRRNDVVHDLMVDLYPLSSYYFGSKEALRVKDEIISDRVIRLKSNYAAHGLRTCVEAVLLVELFKHPHVLLLQYRNSIFKLPGGRLRPGESDIEGLKRKLASKLSVNENVGVSGYEVGECIGMWWRPNFETLMYPFLPPNIKHPKECTKLFLVRLPVHQQFVVPKNFKLLAVPLCQLHENEKTYGPIMSQIPKLLSKFSFNMMEI EEE18D3C747B59CD pabn1_arath Polyadenylate-binding protein 1 PABN1 Nuclear poly(A)-binding protein 1 Poly(A)-binding protein I MWD22.6 At5g51120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVHDEQEHEVYGGEIPEEEEGEMDTEEYEEHGGEEGAAAGDEELEPGSSSRDLEDMKKRIKEIEEEAGALREMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPMRGFMPGVPFYPPYAYGRVPRFRRPMRYRPY B5243EA7809A55DA fip1-cpsf30 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2. However, these assays also suggested that the first 137 amino acids of AtFip1(V) interact with the Arabidopsis homologs of PAP, CPSF30,CstF77, CFIm-25, and PabN1 (summarized in Table 2). fip1-cstf77 2 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey physical association physical association Table 2. However, these assays also suggested that the first 137 amino acids of AtFip1(V) interact with the Arabidopsis homologs of PAP, CPSF30,CstF77, CFIm-25, and PabN1 (summarized in Table 2). fip1-cfim_25 2 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Table 2. However, these assays also suggested that the first 137 amino acids of AtFip1(V) interact with the Arabidopsis homologs of PAP, CPSF30,CstF77, CFIm-25, and PabN1 (summarized in Table 2). fip1-pabn1 2 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Table 2. However, these assays also suggested that the first 137 amino acids of AtFip1(V) interact with the Arabidopsis homologs of PAP, CPSF30,CstF77, CFIm-25, and PabN1 (summarized in Table 2). fip1-pap 2 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association Table 2. However, these assays also suggested that the first 137 amino acids of AtFip1(V) interact with the Arabidopsis homologs of PAP, CPSF30,CstF77, CFIm-25, and PabN1 (summarized in Table 2). fip1-pap-1 1 4 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 3. Specifically, GST-AtPAP[IV] copurified with MBP-FipN but not MBP. fip1-cfim_25-1 1 6 unspecified role unspecified role bait bait c terminal cbp calcium binding protein tagged tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 4. Thus, GSTFipN copurified with MBP-CstF77, MBP-CPSF30, MBP-PabN1, and CFI25-CBD after purification of the latter fusions on their respective affinity matrices fip1-cpsf30-1 1 5 unspecified role unspecified role bait bait n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 4. Thus, GSTFipN copurified with MBP-CstF77, MBP-CPSF30, MBP-PabN1, and CFI25-CBD after purification of the latter fusions on their respective affinity matrices fip1-pabn1-1 1 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 4. Thus, GSTFipN copurified with MBP-CstF77, MBP-CPSF30, MBP-PabN1, and CFI25-CBD after purification of the latter fusions on their respective affinity matrices fip1-cstf77-1 1 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey n terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figure 4. Thus, GSTFipN copurified with MBP-CstF77, MBP-CPSF30, MBP-PabN1, and CFI25-CBD after purification of the latter fusions on their respective affinity matrices