UniProt UniProt http://www.uniprot.org Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation. Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation. J. Biol. Chem. (0021-9258) 2005 imex curation Gao XD., Tachikawa H., Sato T., Jigami Y., Dean N. BioCreative - Critical Assessment of Information Extraction systems in Biology neta.dean@stonybrook.edu 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Gao XD., Tachikawa H., Sato T., Jigami Y., Dean N. BioCreative - Critical Assessment of Information Extraction systems in Biology neta.dean@stonybrook.edu Accepted 2006-SEP-13 by DAVET. 14-DEC-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation. Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation. J. Biol. Chem. (0021-9258) 2005 imex curation Gao XD., Tachikawa H., Sato T., Jigami Y., Dean N. BioCreative - Critical Assessment of Information Extraction systems in Biology neta.dean@stonybrook.edu 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gao XD., Tachikawa H., Sato T., Jigami Y., Dean N. BioCreative - Critical Assessment of Information Extraction systems in Biology neta.dean@stonybrook.edu Accepted 2006-SEP-13 by DAVET. 14-DEC-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2005 Only protein-protein interactions imex curation alg14_yeast UDP-N-acetylglucosamine transferase subunit ALG14 YBR070C YBR0711 Asparagine-linked glycosylation protein 14 ALG14 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKSSKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRFAHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV 53E2D17E18593156 alg13_yeast UDP-N-acetylglucosamine transferase subunit ALG13 YGL047W ALG13 Asparagine-linked glycosylation protein 13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS 9D5CDB366BBC1ED0 9D5CDB366BBC1ED0 alg14-alg13-1 2 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 Alg13 and Alg14 physically interact and under normal conditions, are associated with the ER membrane. alg13-alg14-1 2 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 Alg13 and Alg14 physically interact and under normal conditions, are associated with the ER membrane. alg13-kar2-1 1 4 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2B alg14-kar2-1 1 4 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2A